DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbp2 and Hsd17b14

DIOPT Version :9

Sequence 1:NP_001285777.1 Gene:Fbp2 / 34259 FlyBaseID:FBgn0000640 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001178040.1 Gene:Hsd17b14 / 691018 RGDID:1588673 Length:270 Species:Rattus norvegicus


Alignment Length:204 Identity:41/204 - (20%)
Similarity:80/204 - (39%) Gaps:48/204 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WTGKNVVYVGSFSGIGWQMMMQLMQKDIKMMGIMHRMENVKMMKKLQAINPSVK-----VVFMQM 63
            ::||.||..|...|||..::...:....:          |....|.:|...:|:     .||:..
  Rat     7 YSGKVVVVTGGSRGIGAAIVRAFVDSGAQ----------VVFCDKDEAGGRAVEQELLGTVFIPG 61

  Fly    64 NLMEKMSIEQAMKKMGQMMGHIDVMINGEGV-----------------LLDKDVETTMGMNLTGM 111
            ::.::..::..:.:.....||:|.::|..|.                 ||::        ||.|.
  Rat    62 DVTQEGDLQTLISETVSRFGHLDCVVNNAGYHPPAQLPEETSAQGFRQLLEE--------NLLGA 118

  Fly   112 IQSTMMAMPYMDKTQMGMGGMVVNMSSVYGLEPAPAFSVYAAAMHGILGFTRSMG-DKMIYQKTG 175
            .....:|:|::.|::    |.::|:||:.|.........|.|....:...|:::. |:..|   |
  Rat   119 YTLIKLALPHLRKSK----GNIINISSLVGAIGQSQALTYVATKGAVTAMTKALALDESRY---G 176

  Fly   176 VMFMAMCPG 184
            |....:.||
  Rat   177 VRVNCISPG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbp2NP_001285777.1 ADH_SDR_c_like 7..249 CDD:187584 40/201 (20%)
adh_short 7..198 CDD:278532 40/201 (20%)
Hsd17b14NP_001178040.1 NADB_Rossmann 1..256 CDD:419666 41/204 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.