DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbp2 and hpgd

DIOPT Version :9

Sequence 1:NP_001285777.1 Gene:Fbp2 / 34259 FlyBaseID:FBgn0000640 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001313470.1 Gene:hpgd / 565975 ZFINID:ZDB-GENE-080728-2 Length:261 Species:Danio rerio


Alignment Length:258 Identity:61/258 - (23%)
Similarity:119/258 - (46%) Gaps:42/258 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GKNVVYVGSFSGIGWQMMMQLMQKDIKMMGIMHRMENVKMMKKLQAINPSVK-----------VV 59
            ||..:..|...|||..::.:|:|...|          |.::...|::....|           .:
Zfish     5 GKTALVTGGAQGIGRAVVEELLQNGAK----------VALVDLNQSVGEECKSDLDDQFGEDNCI 59

  Fly    60 FMQMNLMEKMSIEQAMKKMGQMMGHIDVMINGEGVLLDKDVETTMGMNLTGMIQSTMMAMPYMDK 124
            |:|.::.:...:..|.:......|.:|::||..|:..:|:.|.|:.:|||.:|:.|.:|:.:|.|
Zfish    60 FIQCDVTDGEKLGDAFRNTVDRFGRLDIVINNAGINNEKNWEKTIEVNLTSVIKGTYLALEHMSK 124

  Fly   125 TQMGMGGMVVNMSSVYGLEPAPAFSVYAAAMHGILGFTRSMGDKMIYQKTGVMFMAMCPGLTNSE 189
            .....||.::|:||:.....:|...||.|..:|::||:|:|.|.......||...|:||...:::
Zfish   125 EYGKQGGAIINVSSMAAFLHSPHQPVYTATKYGVIGFSRAMADASEQGNYGVRINALCPAFVDTQ 189

  Fly   190 MIMNLRDNVTWHHSESM---VEAIESAKRQMPEEAAMQMIHAMEMMKNGSMWIVSMGQLKEVT 249
            ::.      |..|.|:|   |:..:..|::|.:...::..            :::.|.|:.:|
Zfish   190 LLQ------TVEHEETMGKFVKYKDDFKQRMDKYGVLKPS------------LIAEGMLRLIT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbp2NP_001285777.1 ADH_SDR_c_like 7..249 CDD:187584 59/255 (23%)
adh_short 7..198 CDD:278532 50/201 (25%)
hpgdNP_001313470.1 ADH_SDR_c_like 6..254 CDD:187584 60/257 (23%)
adh_short 6..198 CDD:278532 52/207 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585841
Domainoid 1 1.000 134 1.000 Domainoid score I4954
eggNOG 1 0.900 - - E2759_KOG4169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4534
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6395
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2961
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.