DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbp2 and HSD17B14

DIOPT Version :9

Sequence 1:NP_001285777.1 Gene:Fbp2 / 34259 FlyBaseID:FBgn0000640 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_057330.2 Gene:HSD17B14 / 51171 HGNCID:23238 Length:270 Species:Homo sapiens


Alignment Length:191 Identity:44/191 - (23%)
Similarity:85/191 - (44%) Gaps:22/191 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WTGKNVVYVGSFSGIGWQMMMQLMQKDIKMMGIMHRMENVKMMKKLQAINPSVKVVFMQMNLMEK 68
            :.||.||..|...|||..::...:....::: |..:.|:..  :.|:...|.  .||:..::.::
Human     7 YAGKVVVVTGGGRGIGAGIVRAFVNSGARVV-ICDKDESGG--RALEQELPG--AVFILCDVTQE 66

  Fly    69 MSIEQAMKKMGQMMGHIDVMINGEG--VLLDKDVETT-------MGMNLTGMIQSTMMAMPYMDK 124
            ..::..:.:..:..|.:|.::|..|  ....:..||:       :.:||.|....|.:|:||:.|
Human    67 DDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRK 131

  Fly   125 TQMGMGGMVVNMSSVYGLEPAPAFSVYAAAMHGILGFTRSMG-DKMIYQKTGVMFMAMCPG 184
            :|    |.|:|:||:.|.........|.|....:...|:::. |:..|   ||....:.||
Human   132 SQ----GNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPY---GVRVNCISPG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbp2NP_001285777.1 ADH_SDR_c_like 7..249 CDD:187584 43/188 (23%)
adh_short 7..198 CDD:278532 43/188 (23%)
HSD17B14NP_057330.2 RDH_SDR_c 1..256 CDD:187638 44/191 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.