DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbp2 and RGD1561812

DIOPT Version :9

Sequence 1:NP_001285777.1 Gene:Fbp2 / 34259 FlyBaseID:FBgn0000640 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_038936531.1 Gene:RGD1561812 / 503146 RGDID:1561812 Length:249 Species:Rattus norvegicus


Alignment Length:118 Identity:29/118 - (24%)
Similarity:58/118 - (49%) Gaps:13/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 KDVETTMGMNLTGMIQSTMMAMPYMDKTQMGMGGMVVNMSSVYGLEPAPAF-SVYAAAMHGILGF 161
            :|..:.:.:||.|:|:.|:..:|.:.|.:    |.|||::||  ::...:| ..|..:.:|:..|
  Rat    68 QDFASVLDVNLLGVIEVTLSMVPSVRKAR----GPVVNIASV--MDRVSSFGGGYCISKYGVEAF 126

  Fly   162 TRSMGDKMIYQKTGVMFMAMCPGLTNSEM----IMNLRDNVTWHHSESMVEAI 210
            :.|:..::.|  .||....:.||...:.|    |::....:.|..:.|.|..:
  Rat   127 SDSLRRELSY--FGVKVAIVGPGFFRTNMSNSAILSSNFQMLWDETSSEVREV 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbp2NP_001285777.1 ADH_SDR_c_like 7..249 CDD:187584 29/118 (25%)
adh_short 7..198 CDD:278532 26/104 (25%)
RGD1561812XP_038936531.1 NADB_Rossmann <48..238 CDD:419666 29/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D553511at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.