DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbp2 and hpgd

DIOPT Version :9

Sequence 1:NP_001285777.1 Gene:Fbp2 / 34259 FlyBaseID:FBgn0000640 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001007992.1 Gene:hpgd / 493354 XenbaseID:XB-GENE-942249 Length:264 Species:Xenopus tropicalis


Alignment Length:190 Identity:57/190 - (30%)
Similarity:105/190 - (55%) Gaps:1/190 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GKNVVYVGSFSGIGWQMMMQLMQKDIKMMGI-MHRMENVKMMKKLQAINPSVKVVFMQMNLMEKM 69
            ||..:..|:..|||..|:.:|:||...:..: .:|:........|.....|.:.:|:|.::.::.
 Frog     5 GKVALVTGAAQGIGRAMVEELLQKGAALALVDQNRIAGELCKASLDEQFGSHRTLFIQCDVTDQE 69

  Fly    70 SIEQAMKKMGQMMGHIDVMINGEGVLLDKDVETTMGMNLTGMIQSTMMAMPYMDKTQMGMGGMVV 134
            .::.|.:|..:..|.:|:::|..||..:||.|.|:.:|||.:|:.|.:.:..|.|...|.||:::
 Frog    70 QLKDAFRKTVEHFGRLDILVNNAGVNNEKDWEKTIEVNLTSVIRGTYLGLELMSKKNGGHGGVII 134

  Fly   135 NMSSVYGLEPAPAFSVYAAAMHGILGFTRSMGDKMIYQKTGVMFMAMCPGLTNSEMIMNL 194
            |:||:.||.||....||:|:.||::|||||:.........||....:||...::.::.::
 Frog   135 NISSLAGLTPAAYQPVYSASKHGVIGFTRSIAALASIGNYGVRINTVCPAFVDTPLLESI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbp2NP_001285777.1 ADH_SDR_c_like 7..249 CDD:187584 56/189 (30%)
adh_short 7..198 CDD:278532 56/189 (30%)
hpgdNP_001007992.1 ADH_SDR_c_like 6..254 CDD:187584 56/189 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.