DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbp2 and Adhr

DIOPT Version :9

Sequence 1:NP_001285777.1 Gene:Fbp2 / 34259 FlyBaseID:FBgn0000640 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster


Alignment Length:257 Identity:86/257 - (33%)
Similarity:145/257 - (56%) Gaps:3/257 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFDWTGKNVVYVGSFSGIGWQMMMQLMQKDIKMMGIMHRMENVKMMKKLQAINPSVKVVFMQMNL 65
            |||.|||:|.||....||..:....||.|:|..:.|:...||.:.:.:||:|.||.::.|...::
  Fly     1 MFDLTGKHVCYVADCGGIALETSKVLMTKNIAKLAILQSTENPQAIAQLQSIKPSTQIFFWTYDV 65

  Fly    66 -MEKMSIEQAMKKMGQMMGHIDVMINGEGVLLDKDVETTMGMNLTGMIQSTMMAMPYMDKTQMGM 129
             |.:..:::...::...|.:|||:|||..:..:.:::.|:..|||||:.:....:||||:...|.
  Fly    66 TMAREDMKKYFDEVMVQMDYIDVLINGATLCDENNIDATINTNLTGMMNTVATVLPYMDRKMGGT 130

  Fly   130 GGMVVNMSSVYGLEPAPAFSVYAAAMHGILGFTRSMGDKMIYQKTGVMFMAMCPGLTNSEMIMNL 194
            ||::||::||.||:|:|.|..|:|:..|::|||||:.|.:.|.:.||..||:|.|.|...:...|
  Fly   131 GGLIVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLADPLYYSQNGVAVMAVCCGPTRVFVDREL 195

  Fly   195 RDNVTWHHSESMVEAIESAKRQMPEEAAMQMIHAMEMMKNGSMWIVSMGQLKEVTPTMHWQM 256
            :  ....:.:|..:.:..|..|........:::|:|..:||.:||...|.|:.|....:|.|
  Fly   196 K--AFLEYGQSFADRLRRAPCQSTSVCGQNIVNAIERSENGQIWIADKGGLELVKLHWYWHM 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbp2NP_001285777.1 ADH_SDR_c_like 7..249 CDD:187584 78/242 (32%)
adh_short 7..198 CDD:278532 67/191 (35%)
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 78/242 (32%)
adh_short 7..195 CDD:278532 66/187 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I2453
eggNOG 1 0.900 - - E2759_KOG4169
Homologene 1 1.000 - - H134459
Inparanoid 1 1.050 136 1.000 Inparanoid score I4534
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008550
OrthoInspector 1 1.000 - - mtm6395
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2961
87.860

Return to query results.
Submit another query.