DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbp2 and Adh

DIOPT Version :9

Sequence 1:NP_001285777.1 Gene:Fbp2 / 34259 FlyBaseID:FBgn0000640 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001027266.1 Gene:Adh / 3771877 FlyBaseID:FBgn0000055 Length:256 Species:Drosophila melanogaster


Alignment Length:255 Identity:75/255 - (29%)
Similarity:134/255 - (52%) Gaps:7/255 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FDWTGKNVVYVGSFSGIGWQMMMQLMQKDIKMMGIMHRMENVKMMKKLQAINPSVKVVFMQMNLM 66
            |..|.|||::|....|||.....:|:::|:|.:.|:.|:||...:.:|:||||.|.|.|...::.
  Fly     3 FTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVTFYPYDVT 67

  Fly    67 EKMS-IEQAMKKMGQMMGHIDVMINGEGVLLDKDVETTMGMNLTGMIQSTMMAMPYMDKTQMGMG 130
            ..:: ..:.:|.:...:..:||:|||.|:|.|..:|.|:.:|.||::.:|...:.:.||.:.|.|
  Fly    68 VPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILDFWDKRKGGPG 132

  Fly   131 GMVVNMSSVYGLEPAPAFSVYAAAMHGILGFTRSMGDKMIYQKTGVMFMAMCPGLTNSEMIMNLR 195
            |::.|:.||.|........||:.....::.||.|:.  .:...|||....:.||:|.:.::....
  Fly   133 GIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLA--KLAPITGVTAYTVNPGITRTTLVHTFN 195

  Fly   196 DNVTWHHSESMV-EAIESAKRQMPEEAAMQMIHAMEMMKNGSMWIVSMGQLKEVTPTMHW 254
               :|...|..| |.:.:...|.....|...:.|:|:.:||::|.:.:|.|:.:..|.||
  Fly   196 ---SWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDLGTLEAIQWTKHW 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbp2NP_001285777.1 ADH_SDR_c_like 7..249 CDD:187584 70/243 (29%)
adh_short 7..198 CDD:278532 57/191 (30%)
AdhNP_001027266.1 ADH_SDR_c_like 8..247 CDD:187584 70/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455192
Domainoid 1 1.000 96 1.000 Domainoid score I2453
eggNOG 1 0.900 - - E2759_KOG4169
Homologene 1 1.000 - - H134459
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008550
OrthoInspector 1 1.000 - - otm44427
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.