DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fbp2 and Hpgd

DIOPT Version :9

Sequence 1:NP_001285777.1 Gene:Fbp2 / 34259 FlyBaseID:FBgn0000640 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_032304.2 Gene:Hpgd / 15446 MGIID:108085 Length:269 Species:Mus musculus


Alignment Length:260 Identity:73/260 - (28%)
Similarity:130/260 - (50%) Gaps:20/260 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GKNVVYVGSFSGIGWQMMMQLMQKDIKMMGIMHRME-NVKMMKKLQAINPSVKVVFMQMNLMEKM 69
            ||..:..|:..|||......|:....|:..:...:| .||....|.......|.:|:|.::.::.
Mouse     5 GKVALVTGAAQGIGKAFAEALLLHGAKVALVDWNLEAGVKCKAALDEQFEPQKTLFVQCDVADQK 69

  Fly    70 SIEQAMKKMGQMMGHIDVMINGEGVLLDKDVETTMGMNLTGMIQSTMMAMPYMDKTQMGMGGMVV 134
            .:....:|:....|.:|:::|..||..:|:.|.|:.:||..:|..|.:.:.||.|...|.||:::
Mouse    70 QLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEQTLQINLVSVISGTYLGLDYMSKQNGGEGGIII 134

  Fly   135 NMSSVYGLEPAPAFSVYAAAMHGILGFTRSMGDKMIYQKTGVMFMAMCPGLTNSEMIMNLRDNVT 199
            ||||:.||.|.....||.|:.|||:|||||........|:||....:|||..::.::.::     
Mouse   135 NMSSLAGLMPVAQQPVYCASKHGIIGFTRSAAMAANLMKSGVRLNVICPGFVDTPILESI----- 194

  Fly   200 WHHSESMVEAIESAKRQMPEEAAMQ---MIHAMEMMKNGSMWIVS----MGQLKEVTPT--MHWQ 255
             ...|:|.:.|| .|.|:  :|.|:   ::|. ..:.||.:.::.    .|.:.::|.:  :|:|
Mouse   195 -EKEENMGQYIE-YKDQI--KAMMKFYGVLHP-STIANGLINLIEDDALNGAIMKITASKGIHFQ 254

  Fly   256  255
            Mouse   255  254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fbp2NP_001285777.1 ADH_SDR_c_like 7..249 CDD:187584 69/249 (28%)
adh_short 7..198 CDD:278532 57/191 (30%)
HpgdNP_032304.2 ADH_SDR_c_like 6..254 CDD:187584 71/257 (28%)
adh_short 6..199 CDD:278532 57/198 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841504
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42773
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.