DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4438 and AT5G46020

DIOPT Version :9

Sequence 1:NP_001188753.1 Gene:CG4438 / 34257 FlyBaseID:FBgn0032115 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_568653.1 Gene:AT5G46020 / 834642 AraportID:AT5G46020 Length:164 Species:Arabidopsis thaliana


Alignment Length:185 Identity:65/185 - (35%)
Similarity:94/185 - (50%) Gaps:38/185 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRGKFLSYKGRTRQFTSPEELRQESEDDYDQVSGSGSDSDEKVATRGGANSSSSIAKDRTL--K 63
            |.||||.......|:|:|..::.                            :.:|.|:.|:.  |
plant     1 MGRGKFKGKPTGQRRFSSAADIL----------------------------AGTSAARPRSFKQK 37

  Fly    64 KATRNQKSSSDEVDSSSEDCETESRVARKGVASLIEIDNPNRVSKKGPQKISAIMLDQTK-AGLS 127
            :|...:....:..:.|.|:.|.|:.|.:||..::||:||||||.:|   .:.|..||.:| ..||
plant    38 EAEYEEDVEEESEEESEEESEDEADVKKKGAEAVIEVDNPNRVRQK---TLKAKDLDASKTTELS 99

  Fly   128 RRDQD----QSARKRYEKLHVAGKTTEARADLARLALIRKQREETAARREAEKKA 178
            ||:::    |.|.:||.:|...|||.:||.||.||||||:||||.|.:||.||.|
plant   100 RREREELEKQRAHERYMRLQEQGKTEQARKDLDRLALIRQQREEAAKKREEEKAA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4438NP_001188753.1 PP28 101..177 CDD:287254 41/80 (51%)
AT5G46020NP_568653.1 PP28 76..140 CDD:402043 32/66 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2851
eggNOG 1 0.900 - - E1_KOG3375
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I2019
OMA 1 1.010 - - QHG60099
OrthoDB 1 1.010 - - D1572985at2759
OrthoFinder 1 1.000 - - FOG0004630
OrthoInspector 1 1.000 - - otm2952
orthoMCL 1 0.900 - - OOG6_105501
Panther 1 1.100 - - O PTHR22055
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.