DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4438 and pdap1a

DIOPT Version :9

Sequence 1:NP_001188753.1 Gene:CG4438 / 34257 FlyBaseID:FBgn0032115 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_997797.1 Gene:pdap1a / 322973 ZFINID:ZDB-GENE-030131-1693 Length:158 Species:Danio rerio


Alignment Length:192 Identity:75/192 - (39%)
Similarity:110/192 - (57%) Gaps:41/192 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRGKFLSYKGRTRQFTSPEELRQESEDDYDQVSGSGSDSDEKVATRGGANSSSSIAKDRTLKKA 65
            ||||....:|||.:||::|||:.::..            :.:::...|||...|           
Zfish     1 MPRGGKKGHKGRGKQFSNPEEIDRQMR------------AQKELEENGGAERGS----------- 42

  Fly    66 TRNQKSSSDEVDSSSEDCETESRVARKGVASLIEIDNPNRVSKKGPQKISAIMLDQTKAGLSRRD 130
                 ||..|.::||:|    .:..||||..||||:||||||:|. :|:..|.::..|. ||||:
Zfish    43 -----SSESEEETSSDD----EQPKRKGVEGLIEIENPNRVSQKS-KKVVEIDVNAPKE-LSRRE 96

  Fly   131 QD----QSARKRYEKLHVAGKTTEARADLARLALIRKQREETAARRE---AEKKAANVVTKK 185
            ::    |.|::||.|||:.|||.:|||||||||:|:||||:.|.:||   .||:|....:|:
Zfish    97 REEIEKQKAKERYMKLHLEGKTEQARADLARLAIIKKQREDAAKKREELRKEKEAEEAKSKR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4438NP_001188753.1 PP28 101..177 CDD:287254 42/82 (51%)
pdap1aNP_997797.1 PP28 69..147 CDD:287254 41/79 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589973
Domainoid 1 1.000 95 1.000 Domainoid score I7343
eggNOG 1 0.900 - - E1_KOG3375
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I4564
OMA 1 1.010 - - QHG60099
OrthoDB 1 1.010 - - D1572985at2759
OrthoFinder 1 1.000 - - FOG0004630
OrthoInspector 1 1.000 - - mtm6599
orthoMCL 1 0.900 - - OOG6_105501
Panther 1 1.100 - - O PTHR22055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5851
SonicParanoid 1 1.000 - - X3831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.