DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4438 and CG11444

DIOPT Version :9

Sequence 1:NP_001188753.1 Gene:CG4438 / 34257 FlyBaseID:FBgn0032115 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001284863.1 Gene:CG11444 / 31388 FlyBaseID:FBgn0029715 Length:215 Species:Drosophila melanogaster


Alignment Length:215 Identity:134/215 - (62%)
Similarity:159/215 - (73%) Gaps:26/215 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRGKFLSYKGRTRQFTSPEELRQESEDDYDQVSGSGSDSDEKVATRGGANSSSSIAKDRTLKKA 65
            ||||||:::|||:|.|||||||:||||:|.||.||||||||:|.|..|.|:||:|.||....:||
  Fly     1 MPRGKFVNHKGRSRHFTSPEELQQESEEDSDQTSGSGSDSDDKDAAGGKASSSASKAKAPATRKA 65

  Fly    66 --TRNQKS---------SSDEVDS---SSEDCETESRVARKGVASLIEIDNPNRVSKKGPQKISA 116
              .|||||         ||.|.:|   |.:|.|.|:|.|:|||||||||:|||||:||..||:||
  Fly    66 PVNRNQKSRSAAGAGAASSSESESGEDSDDDSEAEARDAKKGVASLIEIENPNRVTKKATQKLSA 130

  Fly   117 IMLDQTKAG--------LSRRDQD----QSARKRYEKLHVAGKTTEARADLARLALIRKQREETA 169
            |.||...||        ||||:::    |.||:||||||.|||||||:||||||||||:||||.|
  Fly   131 IKLDDGPAGAGGNPKPELSRREREQIEKQRARQRYEKLHAAGKTTEAKADLARLALIRQQREEAA 195

  Fly   170 ARREAEKKAANVVTKKPFAK 189
            |:||||||||:|.||||.||
  Fly   196 AKREAEKKAADVGTKKPGAK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4438NP_001188753.1 PP28 101..177 CDD:287254 56/87 (64%)
CG11444NP_001284863.1 PP28 115..190 CDD:287254 46/74 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460583
Domainoid 1 1.000 84 1.000 Domainoid score I2851
eggNOG 1 0.900 - - E1_KOG3375
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I2019
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60099
OrthoDB 1 1.010 - - D1572985at2759
OrthoFinder 1 1.000 - - FOG0004630
OrthoInspector 1 1.000 - - mtm6599
orthoMCL 1 0.900 - - OOG6_105501
Panther 1 1.100 - - P PTHR22055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5851
SonicParanoid 1 1.000 - - X3831
1312.840

Return to query results.
Submit another query.