DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4438 and Pdap1

DIOPT Version :9

Sequence 1:NP_001188753.1 Gene:CG4438 / 34257 FlyBaseID:FBgn0032115 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001028485.1 Gene:Pdap1 / 231887 MGIID:2448536 Length:181 Species:Mus musculus


Alignment Length:196 Identity:76/196 - (38%)
Similarity:114/196 - (58%) Gaps:41/196 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPR-GKFLSYKGRTRQFTSPEEL--------RQESEDDYDQVSGSGSDSDEKVATRGGANSSSSI 56
            ||: |:...:|||.||:|||||:        ::.:|:|..:..|.|:..|.|             
Mouse     1 MPKGGRKGGHKGRVRQYTSPEEIDAQLQAEKQKANEEDEQEEGGDGASGDPK------------- 52

  Fly    57 AKDRTLKKATRNQKSSSDEVDSSSEDCETESRVARKGVASLIEIDNPNRVSKKGPQKISAIMLDQ 121
                       .:|.|.|..:|..||.:.:.:  ||||..||:|:|||||::. .:|::.:.||.
Mouse    53 -----------KEKKSLDSDESEDEDDDYQQK--RKGVEGLIDIENPNRVAQT-TKKVTQLDLDG 103

  Fly   122 TKAGLSRRDQD----QSARKRYEKLHVAGKTTEARADLARLALIRKQREETAARREAEKKAANVV 182
            .|. ||||:::    |.|::||.|:|:||||.:|:|||||||:|||||||.|.::|.|:||.:..
Mouse   104 PKE-LSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDA 167

  Fly   183 T 183
            |
Mouse   168 T 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4438NP_001188753.1 PP28 101..177 CDD:287254 41/79 (52%)
Pdap1NP_001028485.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 45/144 (31%)
PP28 85..149 CDD:402043 33/65 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..181 8/18 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845408
Domainoid 1 1.000 96 1.000 Domainoid score I7316
eggNOG 1 0.900 - - E1_KOG3375
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4471
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60099
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004630
OrthoInspector 1 1.000 - - otm42696
orthoMCL 1 0.900 - - OOG6_105501
Panther 1 1.100 - - O PTHR22055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5851
SonicParanoid 1 1.000 - - X3831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.