DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4438 and PDAP1

DIOPT Version :9

Sequence 1:NP_001188753.1 Gene:CG4438 / 34257 FlyBaseID:FBgn0032115 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_055706.1 Gene:PDAP1 / 11333 HGNCID:14634 Length:181 Species:Homo sapiens


Alignment Length:197 Identity:79/197 - (40%)
Similarity:117/197 - (59%) Gaps:43/197 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPR-GKFLSYKGRTRQFTSPEEL-------RQESEDDYDQ-VSGSGSDSDEKVATRGGANSSSSI 56
            ||: |:...:|||.||:|||||:       :|::.::.:| ..|.|:..|.|             
Human     1 MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPK------------- 52

  Fly    57 AKDRTLKKATRNQKS-SSDEVDSSSEDCETESRVARKGVASLIEIDNPNRVSKKGPQKISAIMLD 120
                      :.:|| .|||    |||.|.:.:..||||..||:|:|||||::. .:|::.:.||
Human    53 ----------KEKKSLDSDE----SEDEEDDYQQKRKGVEGLIDIENPNRVAQT-TKKVTQLDLD 102

  Fly   121 QTKAGLSRRDQD----QSARKRYEKLHVAGKTTEARADLARLALIRKQREETAARREAEKKAANV 181
            ..|. ||||:::    |.|::||.|:|:||||.:|:|||||||:|||||||.|.::|.|:||.:.
Human   103 GPKE-LSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDD 166

  Fly   182 VT 183
            .|
Human   167 AT 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4438NP_001188753.1 PP28 101..177 CDD:287254 41/79 (52%)
PDAP1NP_055706.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..117 48/144 (33%)
PP28 85..149 CDD:402043 33/65 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..181 8/18 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154938
Domainoid 1 1.000 96 1.000 Domainoid score I7340
eggNOG 1 0.900 - - E1_KOG3375
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 137 1.000 Inparanoid score I4548
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60099
OrthoDB 1 1.010 - - D1572985at2759
OrthoFinder 1 1.000 - - FOG0004630
OrthoInspector 1 1.000 - - otm40620
orthoMCL 1 0.900 - - OOG6_105501
Panther 1 1.100 - - O PTHR22055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5851
SonicParanoid 1 1.000 - - X3831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.