DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh and mctp1

DIOPT Version :9

Sequence 1:NP_001260290.1 Gene:Aldh / 34256 FlyBaseID:FBgn0012036 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_031755510.1 Gene:mctp1 / 548485 XenbaseID:XB-GENE-5812768 Length:919 Species:Xenopus tropicalis


Alignment Length:207 Identity:44/207 - (21%)
Similarity:69/207 - (33%) Gaps:60/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 RSAERA--KKRTVGNPFDLNTEQGPQ-VNEEQM--------EKILGMIK----TGKKQGAKLVAG 389
            ||:.:|  ::|:.|.|.     ..|| ...|.:        |.:.|||:    .|:||....|..
 Frog    26 RSSGKAGGERRSAGTPC-----HSPQPARREDLAAPAPMLEEMVPGMIRWSGLKGRKQMLDRVFS 85

  Fly   390 GSRPEGLPGYFVQPTVFADVQDDMTIAREEIFGPVQQLIRFKKLDEVIERANNSEYGLAAAVFTK 454
            .|:|.......|||:........:|...|    |...|.|.|  |.::.:...|:.       .:
 Frog    86 SSQPNLCCSESVQPSAPCSSPGSITGTPE----PGSALRRLK--DHLLPQNRGSQQ-------VR 137

  Fly   455 DLDKANYIVGGLRA-------------------GTVWVNTYNVLAAQ-APFGGYKMSGHGRENG- 498
            |.|.......||.|                   ||..::....|:.: :.....|..||.:.|. 
 Frog   138 DKDGDGQHKSGLSASPTAGKGHRLSHQKSSSLPGTDCLHQLQPLSTKDSDLAQSKPCGHTKNNNN 202

  Fly   499 ------EYALSN 504
                  :|:..|
 Frog   203 VGTCTTDYSFPN 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AldhNP_001260290.1 PLN02466 9..512 CDD:215259 44/207 (21%)
ALDH_F1AB_F2_RALDH1 34..514 CDD:143459 44/207 (21%)
mctp1XP_031755510.1 C2A_MCTP_PRT 219..339 CDD:176007
C2B_MCTP_PRT 392..507 CDD:176022
C2C_MCTP_PRT 546..664 CDD:176023
PRT_C <807..>864 CDD:337028
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.