Sequence 1: | NP_001260290.1 | Gene: | Aldh / 34256 | FlyBaseID: | FBgn0012036 | Length: | 520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031755510.1 | Gene: | mctp1 / 548485 | XenbaseID: | XB-GENE-5812768 | Length: | 919 | Species: | Xenopus tropicalis |
Alignment Length: | 207 | Identity: | 44/207 - (21%) |
---|---|---|---|
Similarity: | 69/207 - (33%) | Gaps: | 60/207 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 340 RSAERA--KKRTVGNPFDLNTEQGPQ-VNEEQM--------EKILGMIK----TGKKQGAKLVAG 389
Fly 390 GSRPEGLPGYFVQPTVFADVQDDMTIAREEIFGPVQQLIRFKKLDEVIERANNSEYGLAAAVFTK 454
Fly 455 DLDKANYIVGGLRA-------------------GTVWVNTYNVLAAQ-APFGGYKMSGHGRENG- 498
Fly 499 ------EYALSN 504 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Aldh | NP_001260290.1 | PLN02466 | 9..512 | CDD:215259 | 44/207 (21%) |
ALDH_F1AB_F2_RALDH1 | 34..514 | CDD:143459 | 44/207 (21%) | ||
mctp1 | XP_031755510.1 | C2A_MCTP_PRT | 219..339 | CDD:176007 | |
C2B_MCTP_PRT | 392..507 | CDD:176022 | |||
C2C_MCTP_PRT | 546..664 | CDD:176023 | |||
PRT_C | <807..>864 | CDD:337028 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1012 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |