DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh and CG2336

DIOPT Version :9

Sequence 1:NP_001260290.1 Gene:Aldh / 34256 FlyBaseID:FBgn0012036 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster


Alignment Length:208 Identity:45/208 - (21%)
Similarity:82/208 - (39%) Gaps:45/208 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 SPNIILSDTDMD------YAVETAHFGLFFNMGQCCCAGSRTFVEDKIYDEFVERSAERAKKRTV 350
            ||.:::...|.|      |.||:.|...      .|.|.:..|:::.|.:|||:|..:|.:..:.
  Fly   100 SPRLMILCEDGDINCALHYLVESLHDPF------ACNAVATLFLQESILEEFVDRIRDRLEPLST 158

  Fly   351 ---GNPFDLNTEQGPQVNEEQMEKILGMIKTGKKQGAKLVAGGSRPEGLPGYFVQPTVFADVQDD 412
               |:|..:.|.:  ::...|.::|:|..||..:..:.::.          |.:.....||    
  Fly   159 DISGHPVYIMTLE--RIGHLQAKRIVGNPKTVPENASPMLV----------YDLSHRYLAD---- 207

  Fly   413 MTIAREEIFGP--VQQLIRFKKLDEVIE-RANNSEYGLAAAVFTKDLDKANYIVGGLRAGTVWVN 474
                     ||  |..|..|:.:.|.:| :|.......:..::.:.|..|..:|..|......:|
  Fly   208 ---------GPTGVITLHTFRTMKEAVELQAKEPLNFTSVCIWNEKLAAAYELVARLSPLIFTIN 263

  Fly   475 TY--NVLAAQAPF 485
            .|  |:.....||
  Fly   264 CYYVNLNEITLPF 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AldhNP_001260290.1 PLN02466 9..512 CDD:215259 45/208 (22%)
ALDH_F1AB_F2_RALDH1 34..514 CDD:143459 45/208 (22%)
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 45/208 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.