DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh and CG15717

DIOPT Version :9

Sequence 1:NP_001260290.1 Gene:Aldh / 34256 FlyBaseID:FBgn0012036 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001285186.1 Gene:CG15717 / 32262 FlyBaseID:FBgn0030451 Length:252 Species:Drosophila melanogaster


Alignment Length:209 Identity:40/209 - (19%)
Similarity:78/209 - (37%) Gaps:27/209 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 IQLASGNTNLKRVTLELGGKSPNIILSDTDMDYAVETAHFGLFFNMGQCCCAGS--RTFVEDKIY 334
            :|..:..|.|..:......:||.:::...|.|  :.:|...|..::......||  ...:::.|.
  Fly    21 LQPTAQETKLALIPSAPQWRSPQLMVVFEDGD--LHSARHQLLQSLQNPFAEGSVATLLLQESIA 83

  Fly   335 DEFVERSAERAKKRTVGNPFDLNTEQGPQVNEEQMEKILGMIKTGKKQGAKLVAGGSRPEGLPGY 399
            |:||...|:..:      |......:.|... ..:.||       ::..||.|.|.|...|....
  Fly    84 DQFVGLVAQDLR------PLSQEVSKHPSYT-STLAKI-------EELKAKTVQGESLKAGESPV 134

  Fly   400 FVQPTVFADVQDDMT-IAREEIFGPVQQLIRFKKLDEVIERANNSEYGLAAAVFTKDLDKANYIV 463
            .|...|.:.:.:..| :.....|...::..:..|.|.:       .|| ..:::.:.|..|..::
  Fly   135 LVYDCVHSYLGNGATGVVTVHTFRTAKEAGQLAKRDPL-------PYG-QVSLWNEKLGCAYELI 191

  Fly   464 GGLRAGTVWVNTYN 477
            ..|.:..|.:|.:|
  Fly   192 PRLPSDIVAINCFN 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AldhNP_001260290.1 PLN02466 9..512 CDD:215259 40/209 (19%)
ALDH_F1AB_F2_RALDH1 34..514 CDD:143459 40/209 (19%)
CG15717NP_001285186.1 DUF1487 38..250 CDD:254173 37/192 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.