DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh and CG31274

DIOPT Version :9

Sequence 1:NP_001260290.1 Gene:Aldh / 34256 FlyBaseID:FBgn0012036 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster


Alignment Length:165 Identity:31/165 - (18%)
Similarity:56/165 - (33%) Gaps:51/165 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DILYTGVFINNEWHKSKSGKIFETINPTTAEVIAEIQCADKEDIDIAVQAARNAFKLGSPWRRMD 100
            |:|.|         :...||:. |.||.:......|.....||:..:.....:..::...:..:.
  Fly    43 DVLLT---------EDNVGKMI-TPNPYSFSGNISISSCPSEDVSFSESILEDNGRISLAYENLK 97

  Fly   101 ASERGRLLYRLADLMERDQVYLASLETLDNGKPYSMSYNVDLPTAIKNLRYFAGWADKNH---GK 162
            ...|     ||||      .:.|..:.||      :|:|     ..:|||:.:.:.|.:.   .:
  Fly    98 TIPR-----RLAD------KFAAQTKFLD------LSHN-----DFRNLRFLSFFEDLDTLILDR 140

  Fly   163 TIPMDGDFFTYTRHEPVGVCGQIIPWNFPILMMAW 197
            .:.:|.:.|.|                .|.|.:.|
  Fly   141 NVNLDINTFPY----------------LPSLRILW 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AldhNP_001260290.1 PLN02466 9..512 CDD:215259 31/165 (19%)
ALDH_F1AB_F2_RALDH1 34..514 CDD:143459 31/165 (19%)
CG31274NP_732186.1 leucine-rich repeat 111..132 CDD:275378 7/31 (23%)
leucine-rich repeat 133..154 CDD:275378 3/36 (8%)
leucine-rich repeat 155..181 CDD:275378 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.