DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh and alh-3

DIOPT Version :10

Sequence 1:NP_609285.1 Gene:Aldh / 34256 FlyBaseID:FBgn0012036 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_502054.2 Gene:alh-3 / 177999 WormBaseID:WBGene00000109 Length:908 Species:Caenorhabditis elegans


Alignment Length:109 Identity:19/109 - (17%)
Similarity:44/109 - (40%) Gaps:23/109 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SYIEVSIHSEPEDDDHHDLSDLELQQCNSSGSRQH-----LLQSITNLSKP-----DCLFTSAAQ 57
            :::|::|....|.:..|..::.|.|....:...|.     ||:.:...:|.     |.||....:
 Worm   142 AWLEMTIQVREEMEPSHVRANCEAQHKYLTWRAQKDPGHGLLKRLVGEAKAKELLRDFLFNGVDE 206

  Fly    58 SSNESY------------GKAEKRKLMWATLFTVAF-MTAEFVG 88
            ...:::            ..::||.::..:..|..: :|.:|:|
 Worm   207 LGTKTFIDYFPEYQTEDGTVSDKRSIIGKSYETRPWDLTGQFIG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AldhNP_609285.1 ALDH_F1AB_F2_RALDH1 34..514 CDD:143459 13/78 (17%)
alh-3NP_502054.2 FMT_core_FDH_N 1..209 CDD:187716 13/66 (20%)
FDH_Hydrolase_C 214..315 CDD:187731 6/37 (16%)
PP-binding 335..393 CDD:425746
ALDH-SF 423..908 CDD:448367
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.