DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aldh and AgaP_AGAP002764

DIOPT Version :9

Sequence 1:NP_001260290.1 Gene:Aldh / 34256 FlyBaseID:FBgn0012036 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_312157.5 Gene:AgaP_AGAP002764 / 1273203 VectorBaseID:AGAP002764 Length:459 Species:Anopheles gambiae


Alignment Length:265 Identity:58/265 - (21%)
Similarity:102/265 - (38%) Gaps:76/265 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 IILSDTDMDYAVETAHFGLFFNMGQCCCAGSRTFVEDKIYDEFVERSAERAKKRTVGNPFDLNTE 359
            ::....|::.|.:  ...|.:|......|.....|::.:.||||:....:.|      ||..:.:
Mosquito   158 VVFDSCDLESASD--RLALAWNTNAVPWAIRNVLVQENVKDEFVQLVKAKLK------PFSDSQK 214

  Fly   360 QGPQVNEEQMEKILGMIKTGKKQGAKLVAGGS-----RP--EGLPG--YF-------VQPTVFAD 408
            |..:...||      .:...|..||:||...|     :|  ..:||  |.       |||:    
Mosquito   215 QYLRAPFEQ------ALAAAKSYGAQLVQSDSDVNDVKPMLAFVPGVQYLLSNNPTAVQPS---- 269

  Fly   409 VQDDMTIAREEIFGPVQQLIRFKKLDEVIERANNSEYGLAAAVFTKDLDKANYIVGGLRAGTVWV 473
                          |:..:..|:.:.|.:..||::..| :.:::|::|......|.|||:.|:||
Mosquito   270 --------------PIVAVNAFRTVKEALTLANSNNGG-SVSLWTEELSTTLEAVYGLRSQTLWV 319

  Fly   474 NTYNVLAAQAPFGGYKMSG--HGRENGEYAL---------------------SNYTEVKSVIVKV 515
            |:|.....:.|: .::...  :|   .|||:                     .|.|.:||:...|
Mosquito   320 NSYAEFNPECPY-TFRAEDFCYG---SEYAVCEKKVKTVFAPTVATPTNDAEKNRTAIKSLGTYV 380

  Fly   516 AQKNS 520
            |.|.:
Mosquito   381 ANKRN 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AldhNP_001260290.1 PLN02466 9..512 CDD:215259 55/255 (22%)
ALDH_F1AB_F2_RALDH1 34..514 CDD:143459 55/257 (21%)
AgaP_AGAP002764XP_312157.5 ALDH-SF <158..331 CDD:299846 46/205 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.