DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13110 and CG31347

DIOPT Version :9

Sequence 1:NP_609282.1 Gene:CG13110 / 34253 FlyBaseID:FBgn0032111 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_731735.1 Gene:CG31347 / 318693 FlyBaseID:FBgn0051347 Length:143 Species:Drosophila melanogaster


Alignment Length:112 Identity:50/112 - (44%)
Similarity:71/112 - (63%) Gaps:1/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IPEVDMWNVSKSSRIHRLSIFNCDKP-GLKVLDYAAVRGVDRFYLECQDYRDYFKDPYNRVHKPI 66
            :|||||..|||:|:..|.|:.....| ||..:.|.::..||.||||||.|||.|:||||::.:|.
  Fly     6 VPEVDMMTVSKNSQYERESLLKFAPPVGLTNISYGSLYKVDSFYLECQKYRDQFRDPYNKLLRPK 70

  Fly    67 RFTSYAGKCDVKLDTDVEVLSEPTLWRIDRQPIVYPIDYHSDMALGR 113
            .|::|.|||.||:|.::|.|..|....::..|:|||::|...|...|
  Fly    71 MFSTYRGKCGVKIDPELERLKRPAASHVESIPVVYPMEYGHQMDFDR 117



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449430
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014308
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.