DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks30A and CKS2

DIOPT Version :9

Sequence 1:NP_476947.1 Gene:Cks30A / 34250 FlyBaseID:FBgn0010314 Length:74 Species:Drosophila melanogaster
Sequence 2:NP_180364.1 Gene:CKS2 / 817341 AraportID:AT2G27970 Length:83 Species:Arabidopsis thaliana


Alignment Length:67 Identity:47/67 - (70%)
Similarity:60/67 - (89%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQSRGWIHYMIHKPEPHILLFR 69
            |.|||||:|:.|||||||||.|:.|::||..:::|:|||:|||||||||:||.||:|||||:|||
plant     4 IQYSDKYFDDTFEYRHVVLPPEVAKLLPKNRILSESEWRAIGVQQSRGWVHYAIHRPEPHIMLFR 68

  Fly    70 RP 71
            ||
plant    69 RP 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks30ANP_476947.1 CKS 7..72 CDD:395882 46/65 (71%)
CKS2NP_180364.1 PLN00010 1..83 CDD:215027 47/67 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 117 1.000 Domainoid score I1954
eggNOG 1 0.900 - - E1_KOG3484
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H83385
Inparanoid 1 1.050 117 1.000 Inparanoid score I2007
OMA 1 1.010 - - QHG53792
OrthoDB 1 1.010 - - D1377855at2759
OrthoFinder 1 1.000 - - FOG0001114
OrthoInspector 1 1.000 - - otm3387
orthoMCL 1 0.900 - - OOG6_100899
Panther 1 1.100 - - O PTHR23415
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X683
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.