powered by:
Protein Alignment Cks30A and Cks2
DIOPT Version :9
Sequence 1: | NP_476947.1 |
Gene: | Cks30A / 34250 |
FlyBaseID: | FBgn0010314 |
Length: | 74 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_079691.1 |
Gene: | Cks2 / 66197 |
MGIID: | 1913447 |
Length: | 79 |
Species: | Mus musculus |
Alignment Length: | 69 |
Identity: | 54/69 - (78%) |
Similarity: | 62/69 - (89%) |
Gaps: | 0/69 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KDIYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQSRGWIHYMIHKPEPHILL 67
|.|||||||:||.:|||||:||:||.|.|||||||:|.|||.:|||||.||:|||||:|||||||
Mouse 4 KQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILL 68
Fly 68 FRRP 71
||||
Mouse 69 FRRP 72
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Cks30A | NP_476947.1 |
CKS |
7..72 |
CDD:395882 |
51/65 (78%) |
Cks2 | NP_079691.1 |
CKS |
8..73 |
CDD:395882 |
51/65 (78%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3484 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
131 |
1.000 |
Inparanoid score |
I4605 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG53792 |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1377855at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001114 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm43664 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100899 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R205 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X683 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
12 | 11.770 |
|
Return to query results.
Submit another query.