powered by:
Protein Alignment Cks30A and cks2
DIOPT Version :9
Sequence 1: | NP_476947.1 |
Gene: | Cks30A / 34250 |
FlyBaseID: | FBgn0010314 |
Length: | 74 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001016170.1 |
Gene: | cks2 / 548924 |
XenbaseID: | XB-GENE-922081 |
Length: | 79 |
Species: | Xenopus tropicalis |
Alignment Length: | 69 |
Identity: | 55/69 - (79%) |
Similarity: | 62/69 - (89%) |
Gaps: | 0/69 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KDIYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQSRGWIHYMIHKPEPHILL 67
|:|||||||.||.:|||||:|||||.|.|||||||:|.|||.:|||||.||:|||||:|||||||
Frog 4 KNIYYSDKYSDENYEYRHVMLPKELAKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILL 68
Fly 68 FRRP 71
||||
Frog 69 FRRP 72
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Cks30A | NP_476947.1 |
CKS |
7..72 |
CDD:395882 |
52/65 (80%) |
cks2 | NP_001016170.1 |
CKS |
8..73 |
CDD:279455 |
52/65 (80%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
106 |
1.000 |
Domainoid score |
I6480 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1377855at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
mtm9524 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R205 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 5.040 |
|
Return to query results.
Submit another query.