DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks30A and cks2

DIOPT Version :9

Sequence 1:NP_476947.1 Gene:Cks30A / 34250 FlyBaseID:FBgn0010314 Length:74 Species:Drosophila melanogaster
Sequence 2:NP_001016170.1 Gene:cks2 / 548924 XenbaseID:XB-GENE-922081 Length:79 Species:Xenopus tropicalis


Alignment Length:69 Identity:55/69 - (79%)
Similarity:62/69 - (89%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDIYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQSRGWIHYMIHKPEPHILL 67
            |:|||||||.||.:|||||:|||||.|.|||||||:|.|||.:|||||.||:|||||:|||||||
 Frog     4 KNIYYSDKYSDENYEYRHVMLPKELAKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILL 68

  Fly    68 FRRP 71
            ||||
 Frog    69 FRRP 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks30ANP_476947.1 CKS 7..72 CDD:395882 52/65 (80%)
cks2NP_001016170.1 CKS 8..73 CDD:279455 52/65 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 106 1.000 Domainoid score I6480
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377855at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9524
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R205
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.