DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks30A and Cks2

DIOPT Version :9

Sequence 1:NP_476947.1 Gene:Cks30A / 34250 FlyBaseID:FBgn0010314 Length:74 Species:Drosophila melanogaster
Sequence 2:NP_001119555.1 Gene:Cks2 / 498709 RGDID:1562047 Length:79 Species:Rattus norvegicus


Alignment Length:69 Identity:54/69 - (78%)
Similarity:62/69 - (89%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDIYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQSRGWIHYMIHKPEPHILL 67
            |.|||||||:||.:|||||:||:||.|.|||||||:|.|||.:|||||.||:|||||:|||||||
  Rat     4 KQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILL 68

  Fly    68 FRRP 71
            ||||
  Rat    69 FRRP 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks30ANP_476947.1 CKS 7..72 CDD:395882 51/65 (78%)
Cks2NP_001119555.1 CKS 8..73 CDD:395882 51/65 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3484
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4533
OMA 1 1.010 - - QHG53792
OrthoDB 1 1.010 - - D1377855at2759
OrthoFinder 1 1.000 - - FOG0001114
OrthoInspector 1 1.000 - - otm45739
orthoMCL 1 0.900 - - OOG6_100899
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X683
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.