DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks30A and cks1b

DIOPT Version :10

Sequence 1:NP_476947.1 Gene:Cks30A / 34250 FlyBaseID:FBgn0010314 Length:74 Species:Drosophila melanogaster
Sequence 2:NP_001003593.1 Gene:cks1b / 445199 ZFINID:ZDB-GENE-040801-112 Length:79 Species:Danio rerio


Alignment Length:69 Identity:53/69 - (76%)
Similarity:64/69 - (92%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDIYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQSRGWIHYMIHKPEPHILL 67
            |.|||||||.|::||||||:|||::.|.|||||||:|.|||::|||||:||:|||||:|||||||
Zfish     4 KQIYYSDKYDDDKFEYRHVMLPKDIAKRVPKTHLMSETEWRNLGVQQSQGWVHYMIHQPEPHILL 68

  Fly    68 FRRP 71
            ||||
Zfish    69 FRRP 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks30ANP_476947.1 CKS 5..72 CDD:460068 52/67 (78%)
cks1bNP_001003593.1 CKS 6..73 CDD:460068 52/67 (78%)

Return to query results.
Submit another query.