DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cks30A and zgc:86839

DIOPT Version :9

Sequence 1:NP_476947.1 Gene:Cks30A / 34250 FlyBaseID:FBgn0010314 Length:74 Species:Drosophila melanogaster
Sequence 2:NP_001002110.1 Gene:zgc:86839 / 415200 ZFINID:ZDB-GENE-040625-102 Length:75 Species:Danio rerio


Alignment Length:69 Identity:52/69 - (75%)
Similarity:59/69 - (85%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDIYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQSRGWIHYMIHKPEPHILL 67
            |.|||||||.|:.|||||||||:||.|.|||:|||:|.|.|.:|||||.||:|||||:||.||||
Zfish     4 KQIYYSDKYTDDHFEYRHVVLPRELAKQVPKSHLMSEDECRRLGVQQSLGWVHYMIHEPESHILL 68

  Fly    68 FRRP 71
            ||||
Zfish    69 FRRP 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cks30ANP_476947.1 CKS 7..72 CDD:395882 49/65 (75%)
zgc:86839NP_001002110.1 CKS 8..73 CDD:279455 49/65 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5362
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4646
OMA 1 1.010 - - QHG53792
OrthoDB 1 1.010 - - D1377855at2759
OrthoFinder 1 1.000 - - FOG0001114
OrthoInspector 1 1.000 - - otm24485
orthoMCL 1 0.900 - - OOG6_100899
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X683
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.