powered by:
Protein Alignment Cks30A and Y71G12B.27
DIOPT Version :9
Sequence 1: | NP_476947.1 |
Gene: | Cks30A / 34250 |
FlyBaseID: | FBgn0010314 |
Length: | 74 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_490896.1 |
Gene: | Y71G12B.27 / 171745 |
WormBaseID: | WBGene00022162 |
Length: | 118 |
Species: | Caenorhabditis elegans |
Alignment Length: | 70 |
Identity: | 43/70 - (61%) |
Similarity: | 56/70 - (80%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KDIYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQSRGWIHYMIHKPEPHILL 67
:|||||.:|.|:::|||||:||:.:.:.|||..|::|||||..|||||.||.|||:|.||.||||
Worm 2 EDIYYSPRYEDDEYEYRHVILPQAVSRKVPKGRLLSEAEWRRAGVQQSLGWEHYMVHNPEKHILL 66
Fly 68 FRRPK 72
|||.:
Worm 67 FRRKR 71
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Cks30A | NP_476947.1 |
CKS |
7..72 |
CDD:395882 |
40/64 (63%) |
Y71G12B.27 | NP_490896.1 |
CKS |
6..71 |
CDD:279455 |
40/64 (63%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3484 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S367 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1377855at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001114 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100899 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R205 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X683 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
9 | 8.660 |
|
Return to query results.
Submit another query.