DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17005 and CG18870

DIOPT Version :9

Sequence 1:NP_001260287.1 Gene:CG17005 / 34249 FlyBaseID:FBgn0032109 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_001286684.1 Gene:CG18870 / 59218 FlyBaseID:FBgn0042180 Length:335 Species:Drosophila melanogaster


Alignment Length:141 Identity:34/141 - (24%)
Similarity:55/141 - (39%) Gaps:32/141 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 KSFYHITQPLWVQNITMSHLSFSFASRDRGLKLLNM-NLTVPRQSVWPLLVDYRPLDYENEAEIV 266
            |.||.:.:|.  :......|.|...|   |..:..| |||:|....      ...:.|:.:..:|
  Fly    38 KLFYTLAKPF--RGDPTVRLEFEDTS---GAIVTQMWNLTLPHGHT------ANKIKYDCQFRVV 91

  Fly   267 LTYENTKARYKIKARGVLTDEKEQTDMPLKDRECVDFLHVIYPNRVNFE-IC------------L 318
            .:....:..|.|     :|..|.:.| |: .:||:|::.....||...| ||            :
  Fly    92 TSERPRRGIYTI-----ITRLKFRRD-PV-SKECIDYIQFSSGNRSPSERICTDISIDGPAGRLI 149

  Fly   319 REDRTQLVNVH 329
            .:.|.:.||||
  Fly   150 FDQRDRDVNVH 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17005NP_001260287.1 CDC73_N <443..595 CDD:292669
CG18870NP_001286684.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E377
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.