DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment borr and cdca8

DIOPT Version :9

Sequence 1:NP_723450.1 Gene:borr / 34245 FlyBaseID:FBgn0032105 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001007457.1 Gene:cdca8 / 492815 ZFINID:ZDB-GENE-041114-171 Length:276 Species:Danio rerio


Alignment Length:321 Identity:74/321 - (23%)
Similarity:121/321 - (37%) Gaps:75/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RTKIPKNSKRNREVANREEKVRLYELKMDSRLISI-DSLETK---FLSAVDHQVKTLLGQVQKEL 63
            ||:..| ||:|    .:..|:..:.|..|..:.:| :.|:.|   .|...|:..||.|.::...:
Zfish     6 RTQNAK-SKKN----PKAPKLEAFLLDFDDEVHTIVERLKEKTNNLLKDADNLYKTALIKLPMAV 65

  Fly    64 ANLKMPEVLRLFEELDRFSDFKASDQTQLLASMSMSGSAIEGH-------APSATGSRNDEGYLT 121
            ..:...|...|.:......|.|..::.   |.:.:   ||.|:       |..|..|.|     :
Zfish    66 RKMNWIEYCNLEKPKSPVDDSKVREEA---AQVEL---AIAGNHTIPKVAAKEAKSSAN-----S 119

  Fly   122 EDSSIGASGGSILAAHTGSLLRSTKAMRTPGPLHSARARRARRSRSACGDLNILHSAKPPSISSS 186
            ||.::                         .||.|. .::.:.|:.|...     |.||.::|.|
Zfish   120 EDENM-------------------------APLKST-MKKKKASKKAPST-----SKKPRTLSIS 153

  Fly   187 SSS---SRNSRSKLRTPMASRAKAFSADRTPLKQKQMRSGSPTTPPMAFLRYPKPGEVALSKYGS 248
            ...   .|.:|..|.||..|...:.....|||...:.....|.||.:....: :....::|..||
Zfish   154 KQGGTIQRTTRKPLITPARSFLDSSIIGATPLITPRFDPRLPKTPALRSALH-REKVYSMSVNGS 217

  Fly   249 PMVA---QVMPDKFANVNIPIRNGVLSLRPKKLDADEVESNLLENLDEDTLNQIKTLHENL 306
            |:.|   .::      :::||.||...    :|.|.|::|..|..|||..|..|:.|...|
Zfish   218 PLSAGGEDIV------ISVPIGNGECI----QLLASEMDSVDLSQLDEKALRSIRNLQNRL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
borrNP_723450.1 Borealin 196..312 CDD:287483 31/114 (27%)
cdca8NP_001007457.1 Nbl1_Borealin_N 22..76 CDD:287425 11/53 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..158 15/82 (18%)
Borealin 161..274 CDD:287483 33/119 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16040
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.