DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment borr and cdca9

DIOPT Version :9

Sequence 1:NP_723450.1 Gene:borr / 34245 FlyBaseID:FBgn0032105 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_001189355.1 Gene:cdca9 / 100151622 ZFINID:ZDB-GENE-090706-4 Length:255 Species:Danio rerio


Alignment Length:326 Identity:60/326 - (18%)
Similarity:110/326 - (33%) Gaps:105/326 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KRNREVA-----------NREEKVRL----------YELKMDSRLISIDSLETKFLSAVDHQVKT 54
            :|.|:|:           :.|:|:||          :|.:...|:..:::...|.|:.||...|.
Zfish     4 RRTRKVSQDSDGQVDDQHSFEQKIRLTKRKELFIQQFEKEAQDRINEMEANLNKLLATVDRVFKI 68

  Fly    55 LLGQVQKELANLKMPEVLR--LFEELDRFSDFKASDQTQLLASMSMSGSAIEGHAPSATGSRNDE 117
            .|         :|||..|.  |.::|....|....:.|..|...|..........||        
Zfish    69 EL---------MKMPLSLHTTLIKDLMNDDDTSVGEVTMALKCASPEIQKPLSRKPS-------- 116

  Fly   118 GYLTEDSSIGASGGSILAAHTGSLLRSTKAMRTPGPLHSARARRARRSRSACGDLNILHSAKPPS 182
                 ..::.|..|.         .||:...:||   ...:.:..:::         |||:|...
Zfish   117 -----KKALNALAGQ---------QRSSSQSKTP---IEGQKKPTKKT---------LHSSKSTG 155

  Fly   183 ISSSSSSSRNSRSKLR-TPMASRAKAFSADRTPLKQKQMRSGSPTTPPMAFLRYPKPGEVALSKY 246
            ....:|:....|::.| ..::.:|.|...        |.|..|.:.                   
Zfish   156 SLRCASTINAKRTQGRVVKLSDQANALGV--------QFRQTSRSV------------------- 193

  Fly   247 GSPMVAQVMPDKFANVNIPIRNGVLSLRPKKLDADEVESNLLENLDEDTLNQIKTLHENLQMIVN 311
            |..::       .|...|...:|. :|...:.:.||:.   :|.||:..:||::.:.|.:..:.|
Zfish   194 GDELM-------MATATIVTSHGE-TLFLSEDNKDEIN---VELLDDAAVNQMRKIKELMDYLCN 247

  Fly   312 K 312
            |
Zfish   248 K 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
borrNP_723450.1 Borealin 196..312 CDD:287483 19/116 (16%)
cdca9NP_001189355.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 3/19 (16%)
Nbl1_Borealin_N 34..88 CDD:287425 14/62 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..156 12/82 (15%)
Borealin <199..248 CDD:287483 12/52 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16040
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.