DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aust and cdca8

DIOPT Version :9

Sequence 1:NP_001285775.1 Gene:aust / 34244 FlyBaseID:FBgn0032104 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001007457.1 Gene:cdca8 / 492815 ZFINID:ZDB-GENE-041114-171 Length:276 Species:Danio rerio


Alignment Length:276 Identity:57/276 - (20%)
Similarity:98/276 - (35%) Gaps:94/276 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RRQAQRQKADREEKV-RLSQIKMD------SALEKIDEMSKRYKQEVDNQIKVIRGRTDKQLLQM 66
            |::.|..|:.:..|. :|....:|      :.:|::.|.:....::.||..|....:....:.:|
Zfish     4 RKRTQNAKSKKNPKAPKLEAFLLDFDDEVHTIVERLKEKTNNLLKDADNLYKTALIKLPMAVRKM 68

  Fly    67 KMPEF-----------------------LALG--------------------------FKTFAEF 82
            ...|:                       ||:.                          .|:..:.
Zfish    69 NWIEYCNLEKPKSPVDDSKVREEAAQVELAIAGNHTIPKVAAKEAKSSANSEDENMAPLKSTMKK 133

  Fly    83 QRAAIKPPTT----RSLSISR-GRT--RTPQNAL--PPRLQAHSVDRALSGDTMSFV-----RWP 133
            ::|:.|.|:|    |:||||: |.|  ||.:..|  |.|   ..:|.::.|.|....     |.|
Zfish   134 KKASKKAPSTSKKPRTLSISKQGGTIQRTTRKPLITPAR---SFLDSSIIGATPLITPRFDPRLP 195

  Fly   134 RA--------GEMVLSKA--GSPLAVQMRPDRYADVHIPT---RGGVITVKPHKINTVKREVLMQ 185
            :.        .|.|.|.:  ||||:....     |:.|..   .|..|.:...::::|.   |.|
Zfish   196 KTPALRSALHREKVYSMSVNGSPLSAGGE-----DIVISVPIGNGECIQLLASEMDSVD---LSQ 252

  Fly   186 LDENTLNQVKTLNANL 201
            |||..|..::.|...|
Zfish   253 LDEKALRSIRNLQNRL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
austNP_001285775.1 Borealin 97..207 CDD:287483 34/128 (27%)
cdca8NP_001007457.1 Nbl1_Borealin_N 22..76 CDD:287425 8/53 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..158 11/46 (24%)
Borealin 161..274 CDD:287483 30/119 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16040
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.