DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aust and borr

DIOPT Version :9

Sequence 1:NP_001285775.1 Gene:aust / 34244 FlyBaseID:FBgn0032104 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_723450.1 Gene:borr / 34245 FlyBaseID:FBgn0032105 Length:319 Species:Drosophila melanogaster


Alignment Length:318 Identity:98/318 - (30%)
Similarity:145/318 - (45%) Gaps:111/318 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRTKITARRQAQRQKADREEKVRLSQIKMDSALEKIDEMSKRYKQEVDNQIKVIRGRTDKQLLQ 65
            ||||||....:..|:.|:|||||||.::||||.|..||.:..::...||:|:|.:.|:..|:|..
  Fly     1 MPRTKIPKNSKRNREVANREEKVRLYELKMDSRLISIDSLETKFLSAVDHQVKTLLGQVQKELAN 65

  Fly    66 MKMPEFLAL-------------------------------------------GFKT--------- 78
            :||||.|.|                                           |:.|         
  Fly    66 LKMPEVLRLFEELDRFSDFKASDQTQLLASMSMSGSAIEGHAPSATGSRNDEGYLTEDSSIGASG 130

  Fly    79 -------------------------FAEFQRA--------------AIKPPTTRSLSI----SRG 100
                                     .|..:||              :.|||:..|.|.    ||.
  Fly   131 GSILAAHTGSLLRSTKAMRTPGPLHSARARRARRSRSACGDLNILHSAKPPSISSSSSSSRNSRS 195

  Fly   101 RTRTPQNALPPRLQAHSVDRA-------LSGD----TMSFVRWPRAGEMVLSKAGSPLAVQMRPD 154
            :.|||   :..|.:|.|.||.       .||.    .|:|:|:|:.||:.|||.|||:..|:.||
  Fly   196 KLRTP---MASRAKAFSADRTPLKQKQMRSGSPTTPPMAFLRYPKPGEVALSKYGSPMVAQVMPD 257

  Fly   155 RYADVHIPTRGGVITVKPHKINT--VKREVLMQLDENTLNQVKTLNANLGLIVDMANK 210
            ::|:|:||.|.||::::|.|::.  |:..:|..|||:||||:|||:.||.:||:.|::
  Fly   258 KFANVNIPIRNGVLSLRPKKLDADEVESNLLENLDEDTLNQIKTLHENLQMIVNKASQ 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
austNP_001285775.1 Borealin 97..207 CDD:287483 52/126 (41%)
borrNP_723450.1 Borealin 196..312 CDD:287483 50/118 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I15300
eggNOG 1 0.900 - - E1_2E3YB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130853at33392
OrthoFinder 1 1.000 - - FOG0014323
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR16040
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11776
76.920

Return to query results.
Submit another query.