DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aust and cdca9

DIOPT Version :9

Sequence 1:NP_001285775.1 Gene:aust / 34244 FlyBaseID:FBgn0032104 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001189355.1 Gene:cdca9 / 100151622 ZFINID:ZDB-GENE-090706-4 Length:255 Species:Danio rerio


Alignment Length:257 Identity:55/257 - (21%)
Similarity:99/257 - (38%) Gaps:63/257 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRTKITARRQAQRQKADR---EEKVRLSQIKMDSALEKIDEMSKRYKQEVDNQIKVIRGRTDKQL 63
            ||......:.:..|..|:   |:|:||::.|        :...:::::|..::|..:....:|.|
Zfish     3 PRRTRKVSQDSDGQVDDQHSFEQKIRLTKRK--------ELFIQQFEKEAQDRINEMEANLNKLL 59

  Fly    64 LQ---------MKMPEFL--------------ALGFKTFA------EFQRAAIKPPTTRSLSISR 99
            ..         ||||..|              ::|..|.|      |.|:...:.|:.::|:...
Zfish    60 ATVDRVFKIELMKMPLSLHTTLIKDLMNDDDTSVGEVTMALKCASPEIQKPLSRKPSKKALNALA 124

  Fly   100 GRTRTPQNA--------LPPRLQAHSVDRALSGDTMSFVRWPRA-GEMV-LSKAGSPLAVQMRPD 154
            |:.|:...:        .|.:...||.....|....|.:...|. |.:| ||...:.|.||.|..
Zfish   125 GQQRSSSQSKTPIEGQKKPTKKTLHSSKSTGSLRCASTINAKRTQGRVVKLSDQANALGVQFRQT 189

  Fly   155 RYADVHIPTRGGVITVKPHKINTVKREVLMQLDENTLNQVKTLNANLGLIVDMA-NKLGKLK 215
            .      .:.|..:.:....|.|...|.|. |.|:..:::     |:.|:.|.| |::.|:|
Zfish   190 S------RSVGDELMMATATIVTSHGETLF-LSEDNKDEI-----NVELLDDAAVNQMRKIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
austNP_001285775.1 Borealin 97..207 CDD:287483 25/119 (21%)
cdca9NP_001189355.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 4/20 (20%)
Nbl1_Borealin_N 34..88 CDD:287425 9/53 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..156 8/48 (17%)
Borealin <199..248 CDD:287483 13/47 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16040
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.