Sequence 1: | NP_001285775.1 | Gene: | aust / 34244 | FlyBaseID: | FBgn0032104 | Length: | 216 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001189355.1 | Gene: | cdca9 / 100151622 | ZFINID: | ZDB-GENE-090706-4 | Length: | 255 | Species: | Danio rerio |
Alignment Length: | 257 | Identity: | 55/257 - (21%) |
---|---|---|---|
Similarity: | 99/257 - (38%) | Gaps: | 63/257 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 PRTKITARRQAQRQKADR---EEKVRLSQIKMDSALEKIDEMSKRYKQEVDNQIKVIRGRTDKQL 63
Fly 64 LQ---------MKMPEFL--------------ALGFKTFA------EFQRAAIKPPTTRSLSISR 99
Fly 100 GRTRTPQNA--------LPPRLQAHSVDRALSGDTMSFVRWPRA-GEMV-LSKAGSPLAVQMRPD 154
Fly 155 RYADVHIPTRGGVITVKPHKINTVKREVLMQLDENTLNQVKTLNANLGLIVDMA-NKLGKLK 215 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
aust | NP_001285775.1 | Borealin | 97..207 | CDD:287483 | 25/119 (21%) |
cdca9 | NP_001189355.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..24 | 4/20 (20%) | |
Nbl1_Borealin_N | 34..88 | CDD:287425 | 9/53 (17%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 107..156 | 8/48 (17%) | |||
Borealin | <199..248 | CDD:287483 | 13/47 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR16040 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |