DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tai and cyc

DIOPT Version :9

Sequence 1:NP_001245949.1 Gene:tai / 34242 FlyBaseID:FBgn0041092 Length:2047 Species:Drosophila melanogaster
Sequence 2:NP_524168.2 Gene:cyc / 40162 FlyBaseID:FBgn0023094 Length:413 Species:Drosophila melanogaster


Alignment Length:518 Identity:95/518 - (18%)
Similarity:178/518 - (34%) Gaps:170/518 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 KIRRKTDSKVNLPQSQINKCNNEKRRREAENGYIEQLSEILTL---NKRGDMTSTKPDKAAILNQ 283
            |..|.:|.......|:|     |||||:..|.||.:||.::.:   .:|      |.||..:|..
  Fly    22 KSARTSDENRKQNHSEI-----EKRRRDKMNTYINELSSMIPMCFAMQR------KLDKLTVLRM 75

  Fly   284 VVRTYREICDKGQNRDISSTSTNNNNSTTTTNNNTNSNNNNNTSKPQATSTRCSRCATDNCSIHP 348
            .|:..|.|...|                                                 |:||
  Fly    76 AVQHLRGIRGSG-------------------------------------------------SLHP 91

  Fly   349 VQQGEVSSTEPPLPEPSLLLGQVPEISAYFEALEHYISGVGWVLLQVNANGIIESCTQNIRDLIG 413
            ....:.        .||.|..|..:: ...:|.|.::..||.      ..|.|...:.::..::.
  Fly    92 FNGSDY--------RPSFLSDQELKM-IILQASEGFLFVVGC------DRGRILYVSDSVSSVLN 141

  Fly   414 YEKQELYHQPLYMYLYSGDHAKLEPIINTMYNNPNGGNSNSANNSGPGGSSAGTSAGVWGDLEEL 478
            ..:.:|..|..:..|:..|..|::..::::...|.....:           |.|...|..|:.: 
  Fly   142 STQADLLGQSWFDVLHPKDIGKVKEQLSSLEQCPRERLID-----------AKTMLPVKTDVPQ- 194

  Fly   479 NNGNASQGSNSSGAGGLGGAGGAAAGKKRSISTKVRM-------LVKDTRTATQTSSNCEEKPLR 536
                              .......|.:||...::::       :.:::.|::.:.|:.:.|...
  Fly   195 ------------------SLCRLCPGARRSFFCRMKLRTASNNQIKEESDTSSSSRSSTKRKSRL 241

  Fly   537 QSGHQDKYEEVVLIA-----APVKD---DADA---SSSVLCLIT---RPED--ESPLEINIQQHV 585
            .:||  ||..:....     .|:||   |||:   ::::.||:.   .|.:  .|.:..::..|.
  Fly   242 TTGH--KYRVIQCTGYLKSWTPIKDEDQDADSDEQTTNLSCLVAIGRIPPNVRNSTVPASLDNHP 304

  Fly   586 QQQPIEQMTFKLDIH---GKILTLDPTALREPFKQHLQTWVGRLWQDLC--------HPHDLSTL 639
            .   |..:.| :..|   ||.|.:|         |.....:|.|.|::.        |..|::.|
  Fly   305 N---IRHVLF-ISRHSGEGKFLFID---------QRATLVIGFLPQEILGTSFYEYFHNEDIAAL 356

  Fly   640 -KSHLRDIQDSASANSPGAGAGTSVVSRPFRLRLGAPDVYVHVKANSRLFLNQTPGEGDFIMS 701
             :||...:|           ....|.::.:|.|. ..:.|:.:::..|.|.|....|.|:|::
  Fly   357 MESHKMVMQ-----------VPEKVTTQVYRFRC-KDNSYIQLQSEWRAFKNPWTSEIDYIIA 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
taiNP_001245949.1 HLH 235..286 CDD:238036 17/53 (32%)
PAS 377..442 CDD:214512 11/64 (17%)
PAS_11 591..711 CDD:291273 26/123 (21%)
cycNP_524168.2 HLH 31..84 CDD:278439 19/63 (30%)
PAS 111..212 CDD:279347 19/136 (14%)
PAS 111..173 CDD:214512 11/67 (16%)
PAS_11 311..411 CDD:291273 26/119 (22%)
PAS 311..406 CDD:238075 25/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3561
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.