DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tai and Npas2

DIOPT Version :9

Sequence 1:NP_001245949.1 Gene:tai / 34242 FlyBaseID:FBgn0041092 Length:2047 Species:Drosophila melanogaster
Sequence 2:XP_038939510.1 Gene:Npas2 / 316351 RGDID:1309681 Length:855 Species:Rattus norvegicus


Alignment Length:405 Identity:93/405 - (22%)
Similarity:141/405 - (34%) Gaps:108/405 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1311 LATTATTSITTAAS---------TSAAAAAAAAILGEGDSELSKLL------DSVMEYYPDDTPI 1360
            :|..:||::..:|:         .|.||...|.:|.....:|:|.|      .:|::..|  .| 
  Rat   473 MAENSTTALPRSATLPQELPVQGLSQAATMPAPLLSSSSCDLAKQLLPQSLPQTVLQSPP--AP- 534

  Fly  1361 VTNAPSEASAINDIQKSLMLDVESAAFGNDLNQQLMMTQQQQHQQQQQ-------------QQQL 1412
            ||...::.|....|:..|......      |...:...|::.|:.|:|             ||..
  Rat   535 VTQFSAQFSMFQTIKDQLEQRTRI------LQANIRWQQEELHKIQEQLCLVQDSNVQMFLQQPA 593

  Fly  1413 LALQLAQQQQQQRQQHLQQPPAYPG----MLNMQQQQHQQQQQQNQQHIMQRLEAMRNQGNQGFQ 1473
            ::|..:..|:...||.|||.|:.|.    ::|..........|...||:::....|..||.:.. 
  Rat   594 VSLSFSGAQRPAAQQPLQQRPSAPSQPPLVVNTPLPGQITSTQVTNQHLLRESNVMSAQGPKPI- 657

  Fly  1474 RPPPMYPARGRGPMN---------AVATPG---GVVLPAQQQLRNIRQQQQLAAAQQKERLLQQQ 1526
            |...:.||..|...:         :|..||   ..|.|..|.....:........:|. |||..|
  Rat   658 RSSQLLPASSRSLSSLPSQFSSTASVLPPGLSLTTVAPTPQDTSQCQPSPDFGHDRQL-RLLLSQ 721

  Fly  1527 QKQQLL-------VPENASEYWGNSNLQLIIKLIVSYILAGMNAGLNNIGSLLNTTGAPNVSLSR 1584
            ..|.::       .|...|    .:..|      |.|  |.......:..|...::.||...|  
  Rat   722 PIQPMMPGSCDARQPSEVS----RTGRQ------VKY--AQSQVTFPSPDSHPTSSSAPTPVL-- 772

  Fly  1585 TNLPSDAQLSPNF--------AQTLMQQQLSPGRSAP---YSPQPNQ-------------GYA-- 1623
              |...|.|.|.|        ..|.:|||..|...||   :|.||:.             |||  
  Rat   773 --LMGQAVLHPGFPASQPSPLQPTQVQQQPPPYLQAPTSLHSEQPDSLLLSTFSQQPAPLGYAAT 835

  Fly  1624 ----PQFPQPGQRLS 1634
                ||.|:|.:|:|
  Rat   836 QPTQPQPPRPSRRVS 850

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
taiNP_001245949.1 HLH 235..286 CDD:238036
PAS 377..442 CDD:214512
PAS_11 591..711 CDD:291273
Npas2XP_038939510.1 bHLH-PAS_NPAS2_PASD4 1..77 CDD:381580
PAS 84..234 CDD:395786
PAS_11 288..391 CDD:405306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3561
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.