DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-4 and IL1RL1

DIOPT Version :9

Sequence 1:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster
Sequence 2:NP_057316.3 Gene:IL1RL1 / 9173 HGNCID:5998 Length:556 Species:Homo sapiens


Alignment Length:469 Identity:99/469 - (21%)
Similarity:166/469 - (35%) Gaps:135/469 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   717 WECNCKA------KAFLSFLRRHEPMEYETVLRRVEITDDKCPEDC--ICCVDTSNSDSLAYVVD 773
            |..||:|      :|..|||                :.|:...||.  ..|....|.:...|.| 
Human   147 WFKNCQALQGSRYRAHKSFL----------------VIDNVMTEDAGDYTCKFIHNENGANYSV- 194

  Fly   774 CSGKELSEIPQLPTPTYGQTTLVFERNSLKKWPSSLLPGYSSVTRFYLAHNRLSDIDQLPDKLEY 838
                           |..::..|.:......:|....|..:.:....:..|              
Human   195 ---------------TATRSFTVKDEQGFSLF
PVIGAPAQNEIKEVEIGKN-------------- 230

  Fly   839 LDISNNNFSALDDRVRGFLQK---RMNSSQLQLSLFGNPWTCRCEDKDFLVFVKEQAKNIANASA 900
               :|...||...:...||..   ::|.:  :::.||.|   |.:        :|:.:|.:.::.
Human   231 ---ANLTCSACFGKGTQFLAAVLWQLNGT--KITDFGEP---RIQ--------QEEGQNQSFSNG 279

  Fly   901 IQCIDTGRSLIEVEETDICPSVLIYYTSLAVSL----------------------LIIA------ 937
            :.|:|....:.:|:|.|:    |:.|..||::|                      .|||      
Human   280 LACLDMVLRIADVKEEDL----LLQYDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIAVCSVFL 340

  Fly   938 LSINVFICFRQPIMIWFYEHEICLSLAARRELDED-KKYDAFLSF--THKDE----DLIEEFV-- 993
            :.|||.:...:  |.|.....:...:|...:...| |.|||::.:  .:|..    ..:|.||  
Human   341 MLINVLVIILK--MFWIEATLLWRDIAKPYKTRNDGKLYDAYVVYPRNYKSSTDGASRVEHFVHQ 403

  Fly   994 ---DRLENGRHKFRLCFYLRDWLVGESIPDCINQSVKGSRRIIILMTKNFLKSTWGRLEFRLALH 1055
               |.||| :..:.||.|.||.|.||.:...:..:::.|||.|.::|.....:.....|..:|||
Human   404 ILPDVLEN-KCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALH 467

  Fly  1056 ATSRDRCKRLIVVLYPDVEHFDDLDSE-----LRAYM-VLNTYLDRN---------NPNFWNKLM 1105
            ........::|::....:...|.|.:|     |:..| |..|...|.         |..||..:.
Human   468 CALIQNDAKVILIEMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVR 532

  Fly  1106 YSMPHASHLKRSRS 1119
            |.||..|.:.|..|
Human   533 YQMPVPSKIPRKAS 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380
leucine-rich repeat 388..408 CDD:275380
LRR_8 412..465 CDD:290566
leucine-rich repeat 412..432 CDD:275378
LRR_4 432..470 CDD:289563
leucine-rich repeat 433..454 CDD:275378
leucine-rich repeat 455..478 CDD:275378
leucine-rich repeat 479..490 CDD:275378
leucine-rich repeat 632..657 CDD:275378
leucine-rich repeat 658..679 CDD:275378
leucine-rich repeat 680..706 CDD:275378
leucine-rich repeat 707..719 CDD:275378 1/1 (100%)
leucine-rich repeat 771..791 CDD:275380 2/19 (11%)
leucine-rich repeat 793..815 CDD:275378 3/21 (14%)
leucine-rich repeat 816..835 CDD:275378 1/18 (6%)
leucine-rich repeat 836..859 CDD:275378 5/22 (23%)
TIR 974..1110 CDD:214587 42/161 (26%)
IL1RL1NP_057316.3 Ig 16..104 CDD:299845
IG_like 21..104 CDD:214653
Ig2_IL1R_like 118..204 CDD:143234 17/88 (19%)
IG_like 120..197 CDD:214653 16/81 (20%)
Flexible linker 198..211 1/12 (8%)
TIR 380..535 CDD:279864 38/155 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.