DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-4 and il1rapl1b

DIOPT Version :9

Sequence 1:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster
Sequence 2:NP_001136054.1 Gene:il1rapl1b / 557801 ZFINID:ZDB-GENE-090109-2 Length:700 Species:Danio rerio


Alignment Length:485 Identity:106/485 - (21%)
Similarity:176/485 - (36%) Gaps:153/485 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   738 YETVLRRVEITDDKCPEDCICCVDTSNSDSLAYVVDCSGKELSEI--------PQLP--TPTYGQ 792
            |..|||    ....|.:..:......||..|.|.......|.:|:        |.:.  ||...:
Zfish   116 YSCVLR----NSSYCMKVSMALTVAENSSGLCYNSKMRRLEKAELSKSKDILCPDIQDYTPAGSE 176

  Fly   793 TTLVFERNSL-KKWPSSLLPGYSSVTRFYLAHNRLSDIDQLPDKLEYLDISN-------NNF--- 846
            ..:.:.:... |:|.||::              |.:|:..:.|..|. ||.|       ..|   
Zfish   177 PHVTWYKECRPKQWRSSII--------------RTADLLSIRDVRED-DIGNYTCEIQFGRFLVR 226

  Fly   847 --------SALDDRVRGFLQ---KRMNSSQLQLSLFGNP--WTCRC------------------- 879
                    :.|.|:....||   .:::..:|||   |.|  .|||.                   
Zfish   227 RTTELTVTAPLTDKPPKILQPPEHKLSVMELQL---GGPVNLTCRAFFGYSGDVSPLIYWMKGEK 288

  Fly   880 --EDKDFLVFVKEQAKNIANASAIQCIDTGRSLIEVEETDI----C----------------PSV 922
              ||.|.....:.:.|.:......|.:....::..::|.|:    |                ...
Zfish   289 FIEDLDETRIRESEIKMVREHLGEQEVSVSLTIDSLQEEDLGNYSCYVENGHGRRHAIIQLSRRE 353

  Fly   923 LIYYTSLA----VSLLIIALSINVFICFRQPIMIWFYEHEICLSLAARRELD-EDKKYDAFLSFT 982
            |:|...||    ..||::...::::.|:|..:|:::..|      ....::| |:|.|||::|:|
Zfish   354 LMYTVELAGGLGAILLMLIFLVSLYKCYRIELMLFYRNH------FGSEDVDGENKDYDAYVSYT 412

  Fly   983 HKDED------------LIEEFVDRLENGRHKFRLCFYLRDWL-VGESIPD---CINQSVKGSRR 1031
            ..|.|            .:|...|.||. .:.::|....||.: .|..|.|   |::|    |:|
Zfish   413 KVDPDQWSQETREEEHFALEILPDMLEK-HYGYKLFIPDRDLIPTGTYIEDVARCVDQ----SKR 472

  Fly  1032 IIILMTKNF-LKSTWG--RLEFRLALHATSRD------RCKRLIVVL-YPDVEHFDDLDSELRAY 1086
            :||:||.|: ::..|.  .||.||.....|.:      .|..|..:: |.:||       .|:..
Zfish   473 LIIVMTPNYVVRRGWSIFELETRLRNMLVSGEIKVILIECSDLRGIMNYQEVE-------ALKHT 530

  Fly  1087 MVLNTYL-------DRNNPNFWNKLMYSMP 1109
            :.|.|.:       .:.|..||.:|.|.||
Zfish   531 IKLLTVIRWPGPGSSKPNSRFWKQLQYEMP 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380
leucine-rich repeat 388..408 CDD:275380
LRR_8 412..465 CDD:290566
leucine-rich repeat 412..432 CDD:275378
LRR_4 432..470 CDD:289563
leucine-rich repeat 433..454 CDD:275378
leucine-rich repeat 455..478 CDD:275378
leucine-rich repeat 479..490 CDD:275378
leucine-rich repeat 632..657 CDD:275378
leucine-rich repeat 658..679 CDD:275378
leucine-rich repeat 680..706 CDD:275378
leucine-rich repeat 707..719 CDD:275378
leucine-rich repeat 771..791 CDD:275380 5/29 (17%)
leucine-rich repeat 793..815 CDD:275378 4/22 (18%)
leucine-rich repeat 816..835 CDD:275378 2/18 (11%)
leucine-rich repeat 836..859 CDD:275378 9/43 (21%)
TIR 974..1110 CDD:214587 47/169 (28%)
il1rapl1bNP_001136054.1 PHA02785 7..334 CDD:165149 45/239 (19%)
Ig 32..135 CDD:299845 5/22 (23%)
Ig 148..234 CDD:299845 17/100 (17%)
Ig 263..348 CDD:143165 11/84 (13%)
TIR 405..559 CDD:279864 45/165 (27%)
Required for synaptic vesicle accumulation during synaptogenesis 564..700
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.