DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-4 and kek6

DIOPT Version :9

Sequence 1:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster
Sequence 2:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster


Alignment Length:509 Identity:88/509 - (17%)
Similarity:170/509 - (33%) Gaps:197/509 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 CPYRCSCCFEWHTGEFLINCRNLSLDIYPRL-----------PNSIPYKT-------------TL 634
            |...|:|  :|..|:....|.:|.|...|..           .|.|||..             .:
  Fly    38 CASNCTC--KWTNGKKSAICSSLQLTTIPNTLSTELQVLVLNDNHIPYLNREEFSTLGLLNLQRI 100

  Fly   635 YLDRNEIR---------------------KLTNTESLVVAGHASIHKLHMSQNLLREL------- 671
            ||.::|::                     ||...:.....|:..:..|:::.|.|:.|       
  Fly   101 YLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKDTFMGNDRLRILYLNGNPLKRLAAYQFPI 165

  Fly   672 ------------------PLHLLPEN-ITYLDVRNNLLKYLDDGVIAFLEYRENITKIELSGNPW 717
                              |:.|...| :.:|:::||||:.|.:.|   .::..|:..:.|..|||
  Fly   166 LPHLRTLDMHDCLISYIDPMSLANLNLLEFLNLKNNLLESLSEYV---FQHMANLKTLSLEENPW 227

  Fly   718 ECNCKAKAF-----------LSFLRRHEPMEYETVLRRVEITDDK---CP-------EDCICCVD 761
            :||||.:.|           :|.:.:..|.:.:   |..:..||:   ||       .:.:..:|
  Fly   228 QCNCKLRKFRGWYVNSRLSSVSLVCKGPPAQKD---RTWDSVDDELFGCPPRVEIFNNEEVQNID 289

  Fly   762 TSNSDSLAYVVDCSGKELSEIP-QLPTPTYGQTTLVFERNSL---KKWPSSLLPGYSSVTRFYLA 822
            ..::.:.:.:|  .|..|.|:. :|.........::||..|:   |.|        |::|.|   
  Fly   290 IGSNTTFSCLV--YGDPLPEVAWELNGKILDNDNVLFESESIASDKLW--------SNLTVF--- 341

  Fly   823 HNRLSDIDQLPDKLEYLDISNNNFSALDDRVRGFLQKRMNSSQLQLSLFGNPWTCRCEDKDFLVF 887
                 ::..| |...|....:|:..::...:.                               ::
  Fly   342 -----NVTSL-DAGTYACTGSNSIGSMTQNIS-------------------------------IY 369

  Fly   888 VKEQAKNIANASAIQCIDTGRSLIEVEETDICPSVLIYYTSLAVSL-----LIIALSINVFICFR 947
            :.|..:::              |.:..||       .:|..|.:.:     |:|::|..|.:|.|
  Fly   370 LSEIVQHV--------------LEKTPET-------FWYFGLIMGIFGTVFLLISISFVVCLCKR 413

  Fly   948 QPIMIWFYEHEICLSLAARRELDEDKK-YDAFLSFTHKDEDLIEEFVDRLENGR 1000
                            ..|:....:|. ..:.:||..:::.|::..|....|.|
  Fly   414 ----------------TTRQHRHANKAGVKSSVSFNDQEKKLLDSSVTTTTNDR 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380
leucine-rich repeat 388..408 CDD:275380
LRR_8 412..465 CDD:290566
leucine-rich repeat 412..432 CDD:275378
LRR_4 432..470 CDD:289563
leucine-rich repeat 433..454 CDD:275378
leucine-rich repeat 455..478 CDD:275378
leucine-rich repeat 479..490 CDD:275378
leucine-rich repeat 632..657 CDD:275378 6/58 (10%)
leucine-rich repeat 658..679 CDD:275378 6/45 (13%)
leucine-rich repeat 680..706 CDD:275378 7/25 (28%)
leucine-rich repeat 707..719 CDD:275378 4/11 (36%)
leucine-rich repeat 771..791 CDD:275380 5/20 (25%)
leucine-rich repeat 793..815 CDD:275378 5/24 (21%)
leucine-rich repeat 816..835 CDD:275378 3/18 (17%)
leucine-rich repeat 836..859 CDD:275378 2/22 (9%)
TIR 974..1110 CDD:214587 6/28 (21%)
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 4/24 (17%)
LRR_8 96..155 CDD:290566 8/58 (14%)
leucine-rich repeat 97..120 CDD:275380 3/22 (14%)
leucine-rich repeat 121..144 CDD:275380 3/22 (14%)
LRR_4 144..186 CDD:289563 5/41 (12%)
leucine-rich repeat 145..168 CDD:275380 4/22 (18%)
leucine-rich repeat 169..216 CDD:275380 10/49 (20%)
LRRCT 225..274 CDD:214507 13/51 (25%)
Ig 295..367 CDD:143165 17/90 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453712
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.