DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-4 and caps

DIOPT Version :9

Sequence 1:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster
Sequence 2:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster


Alignment Length:525 Identity:110/525 - (20%)
Similarity:200/525 - (38%) Gaps:152/525 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 CPLKCNCSYNRDKSQLEIDCWQKNLTTIPSLPVPKKGSSALVFQSNLLAELPDNSLEGYHNLKSL 436
            ||..|.|    |...|.::|.:..|..:|....|  ....||.::|.|..: |:|::.|..|..|
  Fly    43 CPNGCEC----DDDTLMVNCGEGTLDVLPIALNP--AIQRLVIKNNKLKTI-DSSMQFYAQLTFL 100

  Fly   437 DVSYNQLTSLSVSQLPE-------SLHYLDIRHNKITTLSPQVVEYLYSVNVFNQYGNKWSIYCD 494
            |:|:|.:.:     :||       .|..|.:.||||..:|.:....|.:::|.|..||       
  Fly   101 DLSFNDMLT-----IPERSFAYHAKLQELHLDHNKIGQVSNKTFLGLSTISVLNLRGN------- 153

  Fly   495 EYHLQEFFWYKAKLLRIKTSKFQTIMEYIELS---SKGSFVENFFVQNIDQ---LYLEANEDEII 553
                        .:..::...|..:::..||:   ::.|.::...:..:|.   |||:.|....:
  Fly   154 ------------LIAELEYRTFSPMVKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTV 206

  Fly   554 DAFGPSDKYFN-----LKLMEALNHAIWLFSGEFDEII-----------LHHLNSPCPYRCSCCF 602
                |.:..|.     .:|....|..:.:..|.|.::.           ||:::....       
  Fly   207 ----PGELTFQALHSLAELYLGTNSFMTIPGGAFQDLKGLTRLDLRGAGLHNISGDAL------- 260

  Fly   603 EWHTGEFLINCRNLSLDIYPRLPNSIPYKTTLYLDR----------------------NEIR--- 642
                 :.|::.|.|.|. ..||| :||......|.|                      .|:|   
  Fly   261 -----KGLVSLRFLDLS-DNRLP-AIPTAAFQRLGRLEQLNIGQNDFEVISSGAFSGLRELRHLE 318

  Fly   643 -----KLTNTESLVVAGHASIHKLHMSQNL----LRELPLHLLPENITYLDVRNNLLKYLDDGVI 698
                 :|...||...:|:.::..|::|.|.    |..:.|..|| :::.:.::.|.|..||:|::
  Fly   319 LTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLNELSSIALGGLP-HLSTVVLKANQLSSLDEGLV 382

  Fly   699 AFLEYRENITKIELSGNPWECNCKAKAFLSFLR----------RHEPM--EYETVLRRVEITDDK 751
            .:.:    :..::||.||:||:|:    |.:||          ::.|:  .|.|.||.:.:.  .
  Fly   383 PWAD----LQTLDLSENPFECDCR----LLWLRHLLVSRNASGQYAPVICAYPTALRDLPLA--H 437

  Fly   752 CPEDCICCVDTSNSDSL---AYVVDCSGKELSEIPQLPTPTYGQTTLVFERNSLKKWPSSLLPGY 813
            ..|..:.|...:.|...   ..||.|:..              .|||.....:.:.....:|.|:
  Fly   438 LAEPLLGCAHGAASKQAIIGILVVACAAL--------------ITTLALVLYTCRHRIREMLKGH 488

  Fly   814 SSVTR 818
            |::.|
  Fly   489 SALGR 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380 5/13 (38%)
leucine-rich repeat 388..408 CDD:275380 4/19 (21%)
LRR_8 412..465 CDD:290566 18/59 (31%)
leucine-rich repeat 412..432 CDD:275378 7/19 (37%)
LRR_4 432..470 CDD:289563 13/44 (30%)
leucine-rich repeat 433..454 CDD:275378 7/27 (26%)
leucine-rich repeat 455..478 CDD:275378 8/22 (36%)
leucine-rich repeat 479..490 CDD:275378 4/10 (40%)
leucine-rich repeat 632..657 CDD:275378 8/54 (15%)
leucine-rich repeat 658..679 CDD:275378 7/24 (29%)
leucine-rich repeat 680..706 CDD:275378 5/25 (20%)
leucine-rich repeat 707..719 CDD:275378 4/11 (36%)
leucine-rich repeat 771..791 CDD:275380 3/19 (16%)
leucine-rich repeat 793..815 CDD:275378 5/21 (24%)
leucine-rich repeat 816..835 CDD:275378 1/3 (33%)
leucine-rich repeat 836..859 CDD:275378
TIR 974..1110 CDD:214587
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 7/21 (33%)
LRR_8 96..155 CDD:290566 19/82 (23%)
leucine-rich repeat 97..120 CDD:275380 7/27 (26%)
leucine-rich repeat 121..144 CDD:275380 8/22 (36%)
LRR_8 143..201 CDD:290566 12/76 (16%)
leucine-rich repeat 145..168 CDD:275380 5/41 (12%)
LRR_RI 147..397 CDD:238064 53/291 (18%)
leucine-rich repeat 169..192 CDD:275380 3/22 (14%)
leucine-rich repeat 193..217 CDD:275380 6/27 (22%)
LRR_8 217..276 CDD:290566 10/71 (14%)
leucine-rich repeat 218..241 CDD:275380 4/22 (18%)
leucine-rich repeat 242..265 CDD:275380 3/34 (9%)
LRR_8 265..321 CDD:290566 12/57 (21%)
leucine-rich repeat 266..289 CDD:275380 9/24 (38%)
leucine-rich repeat 290..313 CDD:275380 0/22 (0%)
LRR_8 312..374 CDD:290566 14/62 (23%)
leucine-rich repeat 314..335 CDD:275380 4/20 (20%)
leucine-rich repeat 339..363 CDD:275380 7/24 (29%)
LRRCT 395..445 CDD:214507 14/55 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453539
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.