DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-4 and IL1R1

DIOPT Version :9

Sequence 1:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster
Sequence 2:NP_000868.1 Gene:IL1R1 / 3554 HGNCID:5993 Length:569 Species:Homo sapiens


Alignment Length:615 Identity:114/615 - (18%)
Similarity:222/615 - (36%) Gaps:204/615 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   601 CFEWHTGEFLINCRNLSLDIYPRLPNSIPYKTTLYLDRNEIRKLTNTESLVVAGHASIHKLHMSQ 665
            |.|......|::..| .:|:.|...|...:|.|:...:::.:...:||      .||  ::|..:
Human    23 CKEREEKIILVSSAN-EIDVRPCPLNPNEHKGTITWYKDDSKTPVSTE------QAS--RIHQHK 78

  Fly   666 NLLRELPLHLLPENITYLDVRN------------------NL-----------LKYLDDG--VIA 699
            ..|..:|..:......|..|||                  ||           |....||  |..
Human    79 EKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCP 143

  Fly   700 FLEYRENITKIELSGNPWECNCK------------------------------AKAFLSFLRRHE 734
            ::|:.:|... ||....|..:||                              ..|..::|.:..
Human   144 YMEFFKNENN-ELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQY 207

  Fly   735 PMEYETVLRRVEITDDKCPEDCICCVDTSN-------SDSLAYVVDCSGKELSEIPQLPTPTYGQ 792
            |:  ..|:..:.:.::|.....|  |..:|       ...:..:.:.:| :||:|          
Human   208 PI--TRVIEFITLEENKPTRPVI--VSPANETMEVDLGSQIQLICNVTG-QLSDI---------- 257

  Fly   793 TTLVFERNSLKKWPSSLLPGYSSVTRFYLAHNRLSDIDQLPDKLEYLDISNNNFSALDDRVRGFL 857
                    :..||..|::                 |.|......:|..:.|.     .::.|..|
Human   258 --------AYWKWNGSVI-----------------DEDDPVLGEDYYSVENP-----ANKRRSTL 292

  Fly   858 QKRMNSSQLQLSLFGNPWTCRCEDKDFLVFVKEQAKNI--ANASAIQCI----DTGRSLIEVEET 916
            ...:|.|:::...:.:|:||             .|||.  .:|:.||.|    :..:.:|     
Human   293 ITVLNISEIESRFYKHPFTC-------------FAKNTHGIDAAYIQLIYPVTNFQKHMI----- 339

  Fly   917 DICPSVLIYYTSLAVSLLIIALSINVFICFRQPIMIWFYEHEICLSLAARRELDEDKKYDAFLSF 981
            .||.::.:          ||..|:.::..|:..|::|:  .:.|......:..| .|.|||::.:
Human   340 GICVTLTV----------IIVCSVFIYKIFKIDIVLWY--RDSCYDFLPIKASD-GKTYDAYILY 391

  Fly   982 -------THKDEDL-----IEEFVDRLENGRHKFRLCFYLRDWLVGESIPDCINQSVKGSRRIII 1034
                   :..|.|:     :.|.:::    :..::|..|.||..|||.|.:.||::||.|||:||
Human   392 PKTVGEGSTSDCDIFVFKVLPEVLEK----QCGYKLFIYGRDDYVGEDIVEVINENVKKSRRLII 452

  Fly  1035 LMTKNFLKSTW--GRLEFRLALH-ATSRDRCKRLIVVLYPDVEHFDDLDSELRAYMVLNTYLDRN 1096
            ::.:.....:|  |..|.::|:: |..:|..|.:::.| ..::.::.:...::       ::.:.
Human   453 ILVRETSGFSWLGGSSEEQIAMYNALVQDGIKVVLLEL-EKIQDYEKMPESIK-------FIKQK 509

  Fly  1097 N-----------------PNFWNKLMYSMP 1109
            :                 ..||..:.|.||
Human   510 HGAIRWSGDFTQGPQSAKTRFWKNVRYHMP 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380
leucine-rich repeat 388..408 CDD:275380
LRR_8 412..465 CDD:290566
leucine-rich repeat 412..432 CDD:275378
LRR_4 432..470 CDD:289563
leucine-rich repeat 433..454 CDD:275378
leucine-rich repeat 455..478 CDD:275378
leucine-rich repeat 479..490 CDD:275378
leucine-rich repeat 632..657 CDD:275378 3/24 (13%)
leucine-rich repeat 658..679 CDD:275378 3/20 (15%)
leucine-rich repeat 680..706 CDD:275378 11/56 (20%)
leucine-rich repeat 707..719 CDD:275378 3/11 (27%)
leucine-rich repeat 771..791 CDD:275380 4/19 (21%)
leucine-rich repeat 793..815 CDD:275378 3/21 (14%)
leucine-rich repeat 816..835 CDD:275378 2/18 (11%)
leucine-rich repeat 836..859 CDD:275378 4/22 (18%)
TIR 974..1110 CDD:214587 36/168 (21%)
IL1R1NP_000868.1 Ig1_IL1R_like 24..113 CDD:319308 19/97 (20%)
Ig2_IL1R_like 128..219 CDD:319309 15/93 (16%)
IG 234..328 CDD:214652 24/147 (16%)
TIR 384..540 CDD:214587 36/168 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.