DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-4 and CG42346

DIOPT Version :9

Sequence 1:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster
Sequence 2:NP_001036303.2 Gene:CG42346 / 3355160 FlyBaseID:FBgn0259677 Length:1817 Species:Drosophila melanogaster


Alignment Length:1424 Identity:262/1424 - (18%)
Similarity:463/1424 - (32%) Gaps:552/1424 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QQQQQ----QQLGWCNNKD-----------DPPNS-----HQKSKSNNDARNLNSRV-RVRARVR 68
            |:|||    :|:....|.:           .|.:|     |:..::.|:...:...| |::..::
  Fly    88 QRQQQGRQIEQMAMGTNAEAAAAKKHKHQTKPTDSECEGKHKHKRNRNNVAGVQQHVLRLKLELQ 152

  Fly    69 VV-----------------PGEMRMGDINCSNGLGNIREDYCEIYLDELGENGT----------- 105
            ::                 ||......|  |:..|::|    |:.|.|:|..|.           
  Fly   153 LLLCALLPTALLLGLLPLPPGAAATAMI--SSAKGSVR----ELLLTEMGGGGVGVGVGGSSGGA 211

  Fly   106 -----------------CSIANNEVTTEDYQMKLVFLKLEINWTSPVFHGWN-IFKICNETDYEL 152
                             ...|..|..:.|            |...|.:...: :|..|..|    
  Fly   212 AHPAGGGPGTGLAGGDGGGAAGIECPSFD------------NTACPCYKFEDGLFLECPGT---- 260

  Fly   153 VIISVLGIRSEVDMRISPAVQYLSLLGI-REIS--GYDIYLPSVLITEMDVHHANGPKMVTFKYL 214
               :.:.:||.:: |||..:..||:... |.::  ..|::.|.|.|..:...|::          
  Fly   261 ---TAISLRSTLE-RISAPIHSLSIYDFDRSVTSLSQDVFQPGVHIRHLQFSHSH---------- 311

  Fly   215 YDSTVNSVITNNYIRKTMNNTEKIKIYYHNTFEKTTLTMEKNIFHGKNKMSALIFNGLKIKGLTN 279
                 ...:.:|.:|...::.|.:.                            |.|| |:..:.:
  Fly   312 -----LEALKDNSLRNVRSSLESLS----------------------------IVNG-KLTQMPS 342

  Fly   280 NTFENLTSLNTLIFDN---VFLKDLSF--LRSSTLQ--------------SSLTYCIMKVD---- 321
            ....::..|..|.||.   |.:.|.||  ||.|.|.              :.|..|:.::|    
  Fly   343 RALSSMQKLTALDFDYNEIVRVDDYSFYGLRISKLNMKGNRLQGMPEHAFAGLEECMQEIDVSEN 407

  Fly   322 --NMVDLKSFEKFTNLEIIEVSQYKGFKNFTAFICEPYKSHCKFTLGINEVACPLKCNCSYNRDK 384
              ....|.:..|..:|.|:.:|..: ...|...|          .|..|            |...
  Fly   408 GLRTFPLMALRKLDHLRILRLSNNR-IPTFYGDI----------QLATN------------NASA 449

  Fly   385 SQLEIDCWQKNLTTIPSLPVPKKGSSALVFQSNLLAELPDNSLEGYHNLKSLDVSYNQLTSLSVS 449
            :...:..:|     :|||       ..|...||..||:..:....:..||:|....||:..:.  
  Fly   450 AAAAVGAFQ-----LPSL-------IFLDLSSNQFAEIGPDCFRAFPQLKTLSFYANQIELVQ-- 500

  Fly   450 QLPES------LHYLDIRHNKITTLSPQVVE---YLYSVNV-FNQYGNKWSIYCDEYHLQEFFWY 504
              ||:      |..||:.||:|..|.|:|.|   .|.:|:: .|.......::.:...|:|.|..
  Fly   501 --PEAFKSLRELMSLDMSHNRIIGLDPKVFEKNKRLQTVDLSHNHIHTIGGVFSNLPQLREVFLS 563

  Fly   505 KAKLLRIKTSKFQTIMEYIELSSKGSFVENFFVQNIDQLYLEANEDEIIDAFGPSDKYFNLKLME 569
            :..:|.:....|..                  ..|:|.:|||:|....||   |:          
  Fly   564 ENNILELPADAFTN------------------STNVDVIYLESNAIAHID---PN---------- 597

  Fly   570 ALNHAIWLFSGEFDEIILHHLNSPCPYRCSCCFEWHTGEFLINCRNLSL--DIYPRLPNSIPYK- 631
                   :||                             .|:|..:|.|  :..|.||.::..| 
  Fly   598 -------VFS-----------------------------TLVNLDHLYLRSNFIPLLPVTLFDKS 626

  Fly   632 ---TTLYLDRNEI--------RKLTNTESL-------------VVAGHASIHKLHMSQNLLREL- 671
               |:|.||.|||        |||.:...:             |.....|:.:||:.:|.:.:: 
  Fly   627 TKLTSLSLDNNEIQDLEIGMFRKLEHLREVRLHNNRIRRVRRGVFEPLPSLQELHIQKNSIEDIE 691

  Fly   672 --PLHLLPENITYLDVRNNLLKYLDDGVIAFLEYRENITKIELSGN------PWECNCKAKAFLS 728
              ..|.| ||:.::::::|.|..|:|   .|.:...::..::|..|      |...:.:.|..:.
  Fly   692 PQAFHTL-ENMQHINLQDNQLTVLED---IFPDENSSLLSVQLEANYLHKVHPRTFSRQQKVQIM 752

  Fly   729 FLRRHEPMEYE-------TVLRRVEITDDKCPEDCICCVDTSNSDSLAYVVDCSGKELSEIPQ-L 785
            :|:.::....|       ..|.|:.::|:|..:   ...||..:..|...:|.||.:|.::.: .
  Fly   753 WLKDNQLTRVERSFFADTPQLGRLYLSDNKIRD---IEKDTFVNLLLLQFLDLSGNQLRQLRRDY 814

  Fly   786 PTPTYGQTTLVFERNSLKKWPSSLLPGYS-----SVTRFYLAHN--------------------- 824
            ..|......|...||.::     .:.||:     ::....|:||                     
  Fly   815 FAPLQDLEELSLARNHIE-----AIEGYAFAKLKNLKSLDLSHNPLVQLTRDIFSNEFPLNSLNL 874

  Fly   825 --------------RLSDIDQL--------PDKLEYLDI--------SNNNFS---------ALD 850
                          .|:::::|        |..::.|||        |:||||         .:.
  Fly   875 GNCSLRKLEQHAFKSLTNLNELNLERNQLNPADIQTLDIPNLRRLLLSHNNFSYAGSVGIMAGML 939

  Fly   851 DRVRGFLQKRM---------------NSSQLQLSLFGNPWT------------------CRCEDK 882
            ||:|...|..|               |::.::|.|..|..|                  ||.|..
  Fly   940 DRLRSLQQLSMSNCSLGQIPDLLFAKNTNLVRLDLCDNRLTQINRNIFSGLNVFKELRLCRNELS 1004

  Fly   883 DFLVFVKEQAKNIA--NASAIQCIDTGR------------------------------------S 909
            ||        .:||  |.|.::.:|..|                                    :
  Fly  1005 DF--------PHIALYNLSTLESLDLARNQLASIDFFKLSGTLNLRQLILRDNKITALSGFNAVN 1061

  Fly   910 LIEVEETDICPSVLI----YYTSLAVSLLIIALSINVFICFRQ--------PIMIWF-------- 954
            |.:::..|:..::|:    .:...:::|..:.||.|.|:....        |.:.|.        
  Fly  1062 LTQLDSVDLSGNLLLSLPANFLRHSINLQKVHLSNNRFLQIPSSALSDVSIPRLSWLNLTGNPIN 1126

  Fly   955 -----------YEHE--IC---LSLAARRELDEDKKYDAFLSFTHKDEDLIEEFVDRLENGRHKF 1003
                       |..|  ||   ||:..      .|.::||.:..|.  .|:...:.|:..|..|.
  Fly  1127 RIYTVKEERYPYLKELYICQTNLSILT------SKDFEAFQALQHL--HLVNNRITRISPGAFKS 1183

  Fly  1004 RLCFYLRDWLVG--ESIPDCINQSVKGSRRIIIL-MTKNFLKS----TWGRLEFR-LALHATSRD 1060
            .......|..|.  |.:|   .:.::|.|.:..| ::.|.||.    :...||.: |.|.....|
  Fly  1184 LTNLLTLDLSVNELEMLP---KERLQGLRLLRFLNISHNTLKDLEEFSVDLLEMQTLDLSFNQLD 1245

  Fly  1061 RCKRLIVVLYPDVEHFDDLDSELRAYMVLN--TYLDRNNPNFWNKLMYSMPHASHLKRS 1117
            |..:         :.|.:|...|..:::.|  |.|..:...|..||     |...|:::
  Fly  1246 RISK---------KTFRNLHGLLELFLMGNRMTVLSNDAFRFLRKL-----HVLDLRKN 1290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380 4/22 (18%)
leucine-rich repeat 288..308 CDD:275380 10/24 (42%)
leucine-rich repeat 309..334 CDD:275380 6/44 (14%)
leucine-rich repeat 335..386 CDD:275380 8/50 (16%)
leucine-rich repeat 388..408 CDD:275380 4/19 (21%)
LRR_8 412..465 CDD:290566 17/58 (29%)
leucine-rich repeat 412..432 CDD:275378 5/19 (26%)
LRR_4 432..470 CDD:289563 14/43 (33%)
leucine-rich repeat 433..454 CDD:275378 6/20 (30%)
leucine-rich repeat 455..478 CDD:275378 11/25 (44%)
leucine-rich repeat 479..490 CDD:275378 2/11 (18%)
leucine-rich repeat 632..657 CDD:275378 11/45 (24%)
leucine-rich repeat 658..679 CDD:275378 5/23 (22%)
leucine-rich repeat 680..706 CDD:275378 5/25 (20%)
leucine-rich repeat 707..719 CDD:275378 3/17 (18%)
leucine-rich repeat 771..791 CDD:275380 5/20 (25%)
leucine-rich repeat 793..815 CDD:275378 5/26 (19%)
leucine-rich repeat 816..835 CDD:275378 6/61 (10%)
leucine-rich repeat 836..859 CDD:275378 11/39 (28%)
TIR 974..1110 CDD:214587 32/145 (22%)
CG42346NP_001036303.2 leucine-rich repeat 303..325 CDD:275380 3/36 (8%)
LRR_8 325..384 CDD:290566 17/87 (20%)
leucine-rich repeat 327..350 CDD:275380 5/51 (10%)
leucine-rich repeat 351..461 CDD:275380 26/137 (19%)
LRR_8 373..433 CDD:290566 11/60 (18%)
LRR_RI 397..648 CDD:238064 72/356 (20%)
leucine-rich repeat 399..422 CDD:275380 3/22 (14%)
leucine-rich repeat 462..485 CDD:275380 6/29 (21%)
LRR_8 465..520 CDD:290566 17/58 (29%)
leucine-rich repeat 486..509 CDD:275380 7/26 (27%)
LRR_8 508..567 CDD:290566 16/58 (28%)
leucine-rich repeat 510..533 CDD:275380 10/22 (45%)
LRR_RI 527..785 CDD:238064 63/328 (19%)
leucine-rich repeat 534..556 CDD:275380 3/21 (14%)
LRR_8 555..613 CDD:290566 20/124 (16%)
leucine-rich repeat 557..580 CDD:275380 5/40 (13%)
leucine-rich repeat 581..604 CDD:275380 11/71 (15%)
LRR_8 604..663 CDD:290566 17/58 (29%)
leucine-rich repeat 605..628 CDD:275380 6/22 (27%)
leucine-rich repeat 629..652 CDD:275380 10/22 (45%)
LRR_8 652..711 CDD:290566 10/59 (17%)
leucine-rich repeat 653..676 CDD:275380 1/22 (5%)
leucine-rich repeat 677..700 CDD:275380 5/23 (22%)
leucine-rich repeat 701..748 CDD:275380 8/49 (16%)
leucine-rich repeat 725..736 CDD:275378 2/10 (20%)
leucine-rich repeat 749..772 CDD:275380 2/22 (9%)
LRR_8 771..831 CDD:290566 15/62 (24%)
leucine-rich repeat 773..793 CDD:275380 6/22 (27%)
LRR_RI 804..1076 CDD:238064 45/284 (16%)
LRR_8 821..903 CDD:290566 10/86 (12%)
leucine-rich repeat 821..844 CDD:275380 5/27 (19%)
leucine-rich repeat 845..868 CDD:275380 3/22 (14%)
leucine-rich repeat 869..892 CDD:275380 1/22 (5%)
leucine-rich repeat 893..915 CDD:275380 5/21 (24%)
leucine-rich repeat 916..944 CDD:275380 7/27 (26%)
leucine-rich repeat 945..968 CDD:275380 3/22 (14%)
LRR_8 967..1027 CDD:290566 15/67 (22%)
leucine-rich repeat 969..992 CDD:275380 4/22 (18%)
leucine-rich repeat 993..1014 CDD:275380 7/28 (25%)
LRR_8 1015..1075 CDD:290566 5/59 (8%)
leucine-rich repeat 1017..1040 CDD:275380 2/22 (9%)
leucine-rich repeat 1041..1064 CDD:275380 1/22 (5%)
LRR_RI <1047..1244 CDD:238064 38/207 (18%)
LRR_8 1063..1125 CDD:290566 9/61 (15%)
leucine-rich repeat 1089..1114 CDD:275380 5/24 (21%)
leucine-rich repeat 1115..1162 CDD:275380 10/52 (19%)
LRR_8 1163..1219 CDD:290566 12/60 (20%)
leucine-rich repeat 1163..1186 CDD:275380 5/24 (21%)
leucine-rich repeat 1187..1210 CDD:275380 5/25 (20%)
leucine-rich repeat 1211..1233 CDD:275380 4/21 (19%)
leucine-rich repeat 1234..1257 CDD:275380 6/31 (19%)
LRR_8 1235..1292 CDD:290566 15/70 (21%)
leucine-rich repeat 1258..1279 CDD:275380 4/20 (20%)
leucine-rich repeat 1282..1306 CDD:275380 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453696
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.