DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-4 and IL1RAPL2

DIOPT Version :9

Sequence 1:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster
Sequence 2:NP_059112.1 Gene:IL1RAPL2 / 26280 HGNCID:5997 Length:686 Species:Homo sapiens


Alignment Length:289 Identity:62/289 - (21%)
Similarity:129/289 - (44%) Gaps:70/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   857 LQKRMNSSQLQLSLFGNP--------WTCRCEDKDFLVFVKEQAKNIANASAIQCIDTGR--SLI 911
            |::.:...:::|:|..:.        :||..|:::                       ||  :.:
Human   303 LKEHLGEKEVELALIFDSVVEADLANYTCHVENRN-----------------------GRKHASV 344

  Fly   912 EVEETDICPSVLIYYTSLAVSL----LIIALSINVFICFRQPIMIWFYEHEICLSLAARRELDED 972
            .:.:.|     |||...||..|    |::.|.:.::.|:...:|:::.:|     ..|....|::
Human   345 LLRKKD-----LIYKIELAGGLGAIFLLLVLLVVIYKCYNIELMLFYRQH-----FGADETNDDN 399

  Fly   973 KKYDAFLSFTHKDEDLI-------EEFV-----DRLENGRHKFRLCFYLRDWLVGESIPDCINQS 1025
            |:|||:||:|..|:|.:       |:|.     |.||. .:.::|....||.:...:..:.:.:.
Human   400 KEYDAYLSYTKVDQDTLDCDNPEEEQFALEVLPDVLEK-HYGYKLFIPERDLIPSGTYMEDLTRY 463

  Fly  1026 VKGSRRIIILMTKNF-LKSTWGRLEFRLALHATSRDRCKRLIVVLYPDVE---HFDDLDSELRAY 1086
            |:.|||:||::|.:: |:..|...|....||........::|::...:::   :..:::|..|:.
Human   464 VEQSRRLIIVLTPDYILRRGWSIFELESRLHNMLVSGEIKVILIECTELKGKVNCQEVESLKRSI 528

  Fly  1087 MVLN------TYLDRNNPNFWNKLMYSMP 1109
            .:|:      :...:.|..||..|:|.||
Human   529 KLLSLIKWKGSKSSKLNSKFWKHLVYEMP 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380
leucine-rich repeat 388..408 CDD:275380
LRR_8 412..465 CDD:290566
leucine-rich repeat 412..432 CDD:275378
LRR_4 432..470 CDD:289563
leucine-rich repeat 433..454 CDD:275378
leucine-rich repeat 455..478 CDD:275378
leucine-rich repeat 479..490 CDD:275378
leucine-rich repeat 632..657 CDD:275378
leucine-rich repeat 658..679 CDD:275378
leucine-rich repeat 680..706 CDD:275378
leucine-rich repeat 707..719 CDD:275378
leucine-rich repeat 771..791 CDD:275380
leucine-rich repeat 793..815 CDD:275378
leucine-rich repeat 816..835 CDD:275378
leucine-rich repeat 836..859 CDD:275378 1/1 (100%)
TIR 974..1110 CDD:214587 39/158 (25%)
IL1RAPL2NP_059112.1 Ig 32..133 CDD:325142
Ig2_IL1R_like 146..237 CDD:319309
IG_like 250..347 CDD:214653 8/66 (12%)
TIR 402..563 CDD:307630 39/157 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.