DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-4 and Sigirr

DIOPT Version :9

Sequence 1:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster
Sequence 2:XP_006536238.2 Gene:Sigirr / 24058 MGIID:1344402 Length:414 Species:Mus musculus


Alignment Length:230 Identity:52/230 - (22%)
Similarity:98/230 - (42%) Gaps:49/230 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   918 ICPSVLIYYTSLAVSLLIIALSINVFICFRQPIMIWFYE--HEICLSLAARRELDEDKKYDAFLS 980
            :..|:|:....|.|:||.:...:|        :::|:.:  .|:        |:::.|.|||::|
Mouse   126 VLASLLVLVVLLLVALLYVKCRLN--------MLLWYQDTYGEV--------EMNDGKLYDAYVS 174

  Fly   981 FTHKDEDLIEEFVD-----RLENGRHKFRLCFYLRDWLV-GESIPDCINQSVKGSRRIIILMTKN 1039
            ::...||  .:||:     :||. |..::|....||.|. .|...|.: .::...||:|::::..
Mouse   175 YSDCPED--RKFVNFILKPQLER-RRGYKLFLEDRDLLPRAEPSADLL-VNLSRCRRLIVVLSDA 235

  Fly  1040 FLKSTWGRLEFRLALHATSRDRCKRLIVVLYPDVEHFDDLDSE--------LRAYMVLNTYL--- 1093
            ||...|....||..|       |:.|.:...|....|:....|        ||.:..|.|.:   
Mouse   236 FLSRPWCSQSFREGL-------CRLLELTRRPIFITFEGQRREPIHPALRLLRQHRHLVTLVLWK 293

  Fly  1094 ---DRNNPNFWNKLMYSMPHASHLKRSRSDAETKV 1125
               ...:.:||.:|..::|.....:....|.:|::
Mouse   294 PGSVTPSSDFWKELQLALPRKVQYRPVEGDPQTRL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380
leucine-rich repeat 388..408 CDD:275380
LRR_8 412..465 CDD:290566
leucine-rich repeat 412..432 CDD:275378
LRR_4 432..470 CDD:289563
leucine-rich repeat 433..454 CDD:275378
leucine-rich repeat 455..478 CDD:275378
leucine-rich repeat 479..490 CDD:275378
leucine-rich repeat 632..657 CDD:275378
leucine-rich repeat 658..679 CDD:275378
leucine-rich repeat 680..706 CDD:275378
leucine-rich repeat 707..719 CDD:275378
leucine-rich repeat 771..791 CDD:275380
leucine-rich repeat 793..815 CDD:275378
leucine-rich repeat 816..835 CDD:275378
leucine-rich repeat 836..859 CDD:275378
TIR 974..1110 CDD:214587 38/155 (25%)
SigirrXP_006536238.2 Ig_3 14..106 CDD:372822
TIR 169..331 CDD:366714 41/171 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.