Sequence 1: | NP_523519.2 | Gene: | Toll-4 / 34235 | FlyBaseID: | FBgn0032095 | Length: | 1125 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006536238.2 | Gene: | Sigirr / 24058 | MGIID: | 1344402 | Length: | 414 | Species: | Mus musculus |
Alignment Length: | 230 | Identity: | 52/230 - (22%) |
---|---|---|---|
Similarity: | 98/230 - (42%) | Gaps: | 49/230 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 918 ICPSVLIYYTSLAVSLLIIALSINVFICFRQPIMIWFYE--HEICLSLAARRELDEDKKYDAFLS 980
Fly 981 FTHKDEDLIEEFVD-----RLENGRHKFRLCFYLRDWLV-GESIPDCINQSVKGSRRIIILMTKN 1039
Fly 1040 FLKSTWGRLEFRLALHATSRDRCKRLIVVLYPDVEHFDDLDSE--------LRAYMVLNTYL--- 1093
Fly 1094 ---DRNNPNFWNKLMYSMPHASHLKRSRSDAETKV 1125 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Toll-4 | NP_523519.2 | leucine-rich repeat | 264..287 | CDD:275380 | |
leucine-rich repeat | 288..308 | CDD:275380 | |||
leucine-rich repeat | 309..334 | CDD:275380 | |||
leucine-rich repeat | 335..386 | CDD:275380 | |||
leucine-rich repeat | 388..408 | CDD:275380 | |||
LRR_8 | 412..465 | CDD:290566 | |||
leucine-rich repeat | 412..432 | CDD:275378 | |||
LRR_4 | 432..470 | CDD:289563 | |||
leucine-rich repeat | 433..454 | CDD:275378 | |||
leucine-rich repeat | 455..478 | CDD:275378 | |||
leucine-rich repeat | 479..490 | CDD:275378 | |||
leucine-rich repeat | 632..657 | CDD:275378 | |||
leucine-rich repeat | 658..679 | CDD:275378 | |||
leucine-rich repeat | 680..706 | CDD:275378 | |||
leucine-rich repeat | 707..719 | CDD:275378 | |||
leucine-rich repeat | 771..791 | CDD:275380 | |||
leucine-rich repeat | 793..815 | CDD:275378 | |||
leucine-rich repeat | 816..835 | CDD:275378 | |||
leucine-rich repeat | 836..859 | CDD:275378 | |||
TIR | 974..1110 | CDD:214587 | 38/155 (25%) | ||
Sigirr | XP_006536238.2 | Ig_3 | 14..106 | CDD:372822 | |
TIR | 169..331 | CDD:366714 | 41/171 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |