DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-4 and Il1rap

DIOPT Version :9

Sequence 1:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster
Sequence 2:NP_001152790.1 Gene:Il1rap / 16180 MGIID:104975 Length:685 Species:Mus musculus


Alignment Length:690 Identity:128/690 - (18%)
Similarity:242/690 - (35%) Gaps:205/690 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   475 YLYSVNVFNQYGNKWSIYCDEYHL---QEFFWYKAKLLRIKTSKFQTIMEYIELSSKGSFVENFF 536
            ||.|::.:....:..|..||::.|   ::...::.:..|||...|:..::|...::..|      
Mouse     6 YLMSLSFYGILQSHASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKYNYSTAHSS------ 64

  Fly   537 VQNIDQLYLEANEDEIIDAFGPSDKYFNLKLME----ALNHAIWLFSGEFDEIILHHL-NSPCPY 596
              .:..::....:|..:      ::..|.:|.|    .....:|     |...:|:.. |..|..
Mouse    65 --GLTLIWYWTRQDRDL------EEPINFRLPENRISKEKDVLW-----FRPTLLNDTGNYTCML 116

  Fly   597 R----CS------------CCFE-----------WHTGEFLINCRNLSLDIYPRLPNSIPYKTTL 634
            |    ||            .||.           ...|...|.|.|  :|.|  .|:|:....|.
Mouse   117 RNTTYCSKVAFPLEVVQKDSCFNSAMRFPVHKMYIEHGIHKITCPN--VDGY--FPSSVKPSVTW 177

  Fly   635 YLDRNEIRKLTNTESLVVAGHASIHKLHMSQNLLRELPLHLLPENITYLDVRNNLLKYLDDGVIA 699
            |....||....|.             |....||...:||           |.||      .....
Mouse   178 YKGCTEIVDFHNV-------------LPEGMNLSFFIPL-----------VSNN------GNYTC 212

  Fly   700 FLEYRENITKIELSGNPWECNCKAKAFLSFLRRHEPMEYETVLRRVEITDDKCPEDCICCVDTSN 764
            .:.|.||.....|:                             |.|.:.....|:|.:.....|.
Mouse   213 VVTYPENGRLFHLT-----------------------------RTVTVKVVGSPKDALPPQIYSP 248

  Fly   765 SDSLAYVVDCSGKELSEIPQLPTPTYGQTTLVFERNSLKKWPSSLLPGYSSVTRFYLAHNRLSDI 829
            :|.:.|     .||..|...:|...|  .:.:.:.::...|                      .|
Mouse   249 NDRVVY-----EKEPGEELVIPCKVY--FSFIMDSHNEVWW----------------------TI 284

  Fly   830 D-QLPDKLEYLDISNN---NFSALDDRVRGFLQ--KRMNSSQLQLSLFGNPWTCRCEDKDFLVFV 888
            | :.||.:. :||:.|   ::|:.:|..|..:.  |::....|:.:     :.|...:      .
Mouse   285 DGKKPDDVT-VDITINESVSYSSTEDETRTQILSIKKVTPEDLRRN-----YVCHARN------T 337

  Fly   889 KEQAKNIANASAIQCIDTGRSLIEVEETDICPSVLIYYTSLA----VSLLIIALSINVFICFRQP 949
            |.:|:..|               :|::..|.|.   |...||    .::.::.:.|.|:..:...
Mouse   338 KGEAEQAA---------------KVKQKVIPPR---YTVELACGFGATVFLVVVLIVVYHVYWLE 384

  Fly   950 IMIWFYEHEICLSLAARRELDEDKKYDAFLSFTHKDEDLIEEFV-----DRLENGRHKFRLCFYL 1009
            :::::..|     ......:.:.|:||.::|:....|:  ||||     ..||| ...::||.:.
Mouse   385 MVLFYRAH-----FGTDETILDGKEYDIYVSYARNVEE--EEFVLLTLRGVLEN-EFGYKLCIFD 441

  Fly  1010 RDWLVGESIPDCINQSVKGSRRIIILMTKNFL-KSTWGRLEFRLALHATSRDRCKRLIVVLYPDV 1073
            ||.|.|.:..:.:...::.|||:|::::.::: :.:...|||:|.:...:....| ||||.|..:
Mouse   442 RDSLPGGNTVEAVFDFIQRSRRMIVVLSPDYVTEKSISMLEFKLGVMCQNSIATK-LIVVEYRPL 505

  Fly  1074 EHFDDLDSELRAYMVLNTYLDRNNPN----FWNKLMYSMP 1109
            |.......:|:..:...::....:.:    ||..|..::|
Mouse   506 EQPHPGIMQLKESVSFVSWKGEKSKHSGSKFWKALRLALP 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380
leucine-rich repeat 388..408 CDD:275380
LRR_8 412..465 CDD:290566
leucine-rich repeat 412..432 CDD:275378
LRR_4 432..470 CDD:289563
leucine-rich repeat 433..454 CDD:275378
leucine-rich repeat 455..478 CDD:275378 2/2 (100%)
leucine-rich repeat 479..490 CDD:275378 0/10 (0%)
leucine-rich repeat 632..657 CDD:275378 5/24 (21%)
leucine-rich repeat 658..679 CDD:275378 5/20 (25%)
leucine-rich repeat 680..706 CDD:275378 4/25 (16%)
leucine-rich repeat 707..719 CDD:275378 1/11 (9%)
leucine-rich repeat 771..791 CDD:275380 4/19 (21%)
leucine-rich repeat 793..815 CDD:275378 1/21 (5%)
leucine-rich repeat 816..835 CDD:275378 3/19 (16%)
leucine-rich repeat 836..859 CDD:275378 6/27 (22%)
TIR 974..1110 CDD:214587 37/146 (25%)
Il1rapNP_001152790.1 Ig1_IL1R_like 25..132 CDD:409584 20/125 (16%)
Ig strand B 43..47 CDD:409584 2/3 (67%)
Ig strand C 67..71 CDD:409584 0/3 (0%)
Ig strand E 97..101 CDD:409584 1/8 (13%)
Ig strand F 111..116 CDD:409584 2/4 (50%)
Ig strand G 124..127 CDD:409584 0/2 (0%)
Ig 145..235 CDD:416386 27/152 (18%)
Ig strand A 145..150 CDD:409353 0/4 (0%)
Ig strand A 145..150 CDD:409353 0/4 (0%)
Ig strand B 156..160 CDD:409353 1/3 (33%)
Ig strand B 156..160 CDD:409353 1/3 (33%)
Ig strand C 174..179 CDD:409353 1/4 (25%)
Ig strand C 174..179 CDD:409353 1/4 (25%)
Ig strand C' 182..184 CDD:409353 0/1 (0%)
Ig strand C' 182..184 CDD:409353 0/1 (0%)
Ig strand D 189..193 CDD:409353 2/16 (13%)
Ig strand D 189..193 CDD:409353 2/16 (13%)
Ig strand E 195..200 CDD:409353 2/4 (50%)
Ig strand E 195..200 CDD:409353 2/4 (50%)
Ig strand F 209..218 CDD:409353 1/8 (13%)
Ig strand F 209..218 CDD:409353 1/8 (13%)
Ig strand G 221..234 CDD:409353 3/41 (7%)
Ig strand G 221..234 CDD:409353 3/41 (7%)
Ig3_IL1RAP 243..349 CDD:409525 26/161 (16%)
Ig strand B 262..266 CDD:409525 0/3 (0%)
Ig strand C 279..283 CDD:409525 1/25 (4%)
Ig strand E 314..318 CDD:409525 0/3 (0%)
Ig strand F 329..334 CDD:409525 1/9 (11%)
Ig strand G 341..344 CDD:409525 1/2 (50%)
TIR 404..547 CDD:214587 37/146 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.