DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-4 and Il1r2

DIOPT Version :9

Sequence 1:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster
Sequence 2:NP_446405.1 Gene:Il1r2 / 117022 RGDID:621147 Length:416 Species:Rattus norvegicus


Alignment Length:177 Identity:37/177 - (20%)
Similarity:64/177 - (36%) Gaps:42/177 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 DKSQL----EIDCWQKNLTTIPSLPVPKKGSSALV--FQSNLLAELPDNSLEGYHNLKSLD--VS 439
            |.|||    |...|.|: .|:..||..::.|...:  |::....|.....|:.:.|.::..  ||
  Rat    86 DSSQLIPGDEPRMWVKD-DTLWVLPAVQQDSGTYICTFRNASHCEQMSLELKVFKNTEASFPLVS 149

  Fly   440 YNQLTSLSVSQLPESLHYLDIRHNKITTLSPQVVEYL----------YSVNVFNQYGNK------ 488
            |.|:::||.:.|               .:.|.:.|::          |..::....|||      
  Rat   150 YLQISALSSTGL---------------LVCPDLKEFISSRTDGKIQWYKGSILLDKGNKKFLSAG 199

  Fly   489 --WSIYCDEYHLQEFFWYKAKLLRIKTSKFQTIMEYIELSSKGSFVE 533
              ..:......:.:..:|:..:......|...|...|||..||...|
  Rat   200 DPTRLLISNTSMGDAGYYRCVMTFTYEGKEYNITRNIELRVKGITTE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380 1/2 (50%)
leucine-rich repeat 388..408 CDD:275380 6/19 (32%)
LRR_8 412..465 CDD:290566 11/56 (20%)
leucine-rich repeat 412..432 CDD:275378 3/21 (14%)
LRR_4 432..470 CDD:289563 8/39 (21%)
leucine-rich repeat 433..454 CDD:275378 7/22 (32%)
leucine-rich repeat 455..478 CDD:275378 2/32 (6%)
leucine-rich repeat 479..490 CDD:275378 3/18 (17%)
leucine-rich repeat 632..657 CDD:275378
leucine-rich repeat 658..679 CDD:275378
leucine-rich repeat 680..706 CDD:275378
leucine-rich repeat 707..719 CDD:275378
leucine-rich repeat 771..791 CDD:275380
leucine-rich repeat 793..815 CDD:275378
leucine-rich repeat 816..835 CDD:275378
leucine-rich repeat 836..859 CDD:275378
TIR 974..1110 CDD:214587
Il1r2NP_446405.1 PHA02826 38..240 CDD:165173 34/169 (20%)
Ig 44..137 CDD:299845 14/51 (27%)
Ig 148..242 CDD:299845 19/108 (18%)
I-set 249..343 CDD:254352
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 396..416
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.