DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-4 and IL1RAPL1

DIOPT Version :9

Sequence 1:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster
Sequence 2:NP_055086.1 Gene:IL1RAPL1 / 11141 HGNCID:5996 Length:696 Species:Homo sapiens


Alignment Length:423 Identity:103/423 - (24%)
Similarity:169/423 - (39%) Gaps:112/423 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   777 KELS--EIPQLPTPTYGQTTLVFERNSLKKWPSSLLPGYSSVTRFYLAHNRLSDIDQLPDKLEY- 838
            ||:|  :|.....||.....|.::....|.|..|::  :...| ..:...|..||.....:|:| 
Human   160 KEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIV--FKRDT-LLIREVREDDIGNYTCELKYG 221

  Fly   839 ---------LDISNNNFSALDDRVRGFL---QKRMNSSQLQLSLFGNPWTCRC-----EDKDFLV 886
                     |.::    :.|.|:....|   :.::...:.||....| .|||.     .|...|:
Human   222 GFVVRRTTELTVT----APLTDKPPKLLYPMESKLTIQETQLGDSAN-LTCRAFFGYSGDVSPLI 281

  Fly   887 -------FVKEQAKNIANASAIQCI-------DTGRSLI--EVEETDI----C----------PS 921
                   |:::..:|....|.|:.:       :...|||  .|||.|:    |          .|
Human   282 YWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHAS 346

  Fly   922 VLIY-----YT-----SLAVSLLIIALSINVFICFRQPIMIWFYEHEICLSLAARRELDEDKK-Y 975
            ||::     ||     .|...||::...:.::.|::..||:::..|      ....|||.|.| |
Human   347 VLLHKRELMYTVELAGGLGAILLLLVCLVTIYKCYKIEIMLFYRNH------FGAEELDGDNKDY 405

  Fly   976 DAFLSFTHKDED------------LIEEFVDRLENGRHKFRLCFYLRDWL-VGESIPD---CINQ 1024
            ||:||:|..|.|            .:|...|.||. .:.::|....||.: .|..|.|   |::|
Human   406 DAYLSYTKVDPDQWNQETGEEERFALEILPDMLEK-HYGYKLFIPDRDLIPTGTYIEDVARCVDQ 469

  Fly  1025 SVKGSRRIIILMTKNF-LKSTWG--RLEFRLALHATSRD------RCKRLIVVL-YPDVEHFDDL 1079
                |:|:||:||.|: ::..|.  .||.||.....:.:      .|..|..:: |.:||   .|
Human   470 ----SKRLIIVMTPNYVVRRGWSIFELETRLRNMLVTGEIKVILIECSELRGIMNYQEVE---AL 527

  Fly  1080 DSELRAYMVLNTY---LDRNNPNFWNKLMYSMP 1109
            ...::...|:..:   .::.|..||.:|.|.||
Human   528 KHTIKLLTVIKWHGPKCNKLNSKFWKRLQYEMP 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380
leucine-rich repeat 388..408 CDD:275380
LRR_8 412..465 CDD:290566
leucine-rich repeat 412..432 CDD:275378
LRR_4 432..470 CDD:289563
leucine-rich repeat 433..454 CDD:275378
leucine-rich repeat 455..478 CDD:275378
leucine-rich repeat 479..490 CDD:275378
leucine-rich repeat 632..657 CDD:275378
leucine-rich repeat 658..679 CDD:275378
leucine-rich repeat 680..706 CDD:275378
leucine-rich repeat 707..719 CDD:275378
leucine-rich repeat 771..791 CDD:275380 6/15 (40%)
leucine-rich repeat 793..815 CDD:275378 4/21 (19%)
leucine-rich repeat 816..835 CDD:275378 4/18 (22%)
leucine-rich repeat 836..859 CDD:275378 6/35 (17%)
TIR 974..1110 CDD:214587 47/166 (28%)
IL1RAPL1NP_055086.1 Ig1_IL1RAPL-1_like 32..135 CDD:143304
Ig 148..239 CDD:386229 18/85 (21%)
IGc2 260..341 CDD:197706 18/81 (22%)
TIR 405..559 CDD:366714 44/161 (27%)
Interaction with NCS1. /evidence=ECO:0000269|PubMed:12783849 549..644 6/12 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 659..680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.