DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12439 and CG34181

DIOPT Version :10

Sequence 1:NP_609274.2 Gene:CG12439 / 34234 FlyBaseID:FBgn0032094 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001097130.1 Gene:CG34181 / 5740634 FlyBaseID:FBgn0085210 Length:203 Species:Drosophila melanogaster


Alignment Length:142 Identity:48/142 - (33%)
Similarity:73/142 - (51%) Gaps:29/142 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IIATGV---LNILGISFFVAQPKDRCSAAPPVGKYIFLLAILLLFWDSDMIPRKLKPFSP--RIF 66
            |:|.|:   ..::|..||.|||:||||.||.:..::||.|.|...||..:.||:....|.  ||.
  Fly     3 IVAVGLAAFFQLMGCYFFFAQPQDRCSPAPNLASWLFLGATLCFLWDIKIYPRRFMHMSRFWRIL 67

  Fly    67 ACGDLLFTIFFTEIILLVGWCGLERMTYRFIFSV---------CRGKPGCNY-----GLMTFCSI 117
            .  :::.:||..|:..::.||.||    :|:||:         |..:|. ::     ||:| ..|
  Fly    68 I--EIVASIFLAEVGTVIIWCALE----KFLFSLTNELVNLTQCSCRPS-HFVYWLSGLIT-SLI 124

  Fly   118 LGAVGSLCIVLE 129
            .||:  |..|||
  Fly   125 SGAM--LWYVLE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12439NP_609274.2 DUF4818 31..139 CDD:465013 35/115 (30%)
CG34181NP_001097130.1 DUF4818 30..144 CDD:465013 35/115 (30%)

Return to query results.
Submit another query.