DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and dpr21

DIOPT Version :10

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:253 Identity:71/253 - (28%)
Similarity:107/253 - (42%) Gaps:43/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 NVPTSNLNIVVEE-----------PEF-TEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQS 152
            ||..::|.::.|.           |.| |...:|||...|....|.|.:||||:..|:|:.....
  Fly    27 NVTVTDLYLISENIVPMKRVLDRGPYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDL 91

  Fly   153 AILTVHNHVITRNPRISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNV--V 215
            .:|||.....|.:.|.:..::|  :...|.|.|......|.|.|.||::|.   ...||..|  |
  Fly    92 HLLTVSESTYTSDQRFTSIYNK--QTGDWSLQIKFPQLRDSGIYECQVSTT---PPVGYTMVFSV 151

  Fly   216 VPPNIDDSLSSSDVIVREGANISLRCRASGSPRP--IIKWKRD------DNSRIAINKNHIVNEW 272
            |.| |...|...::.:..|:.::|.|.....|.|  .::|..:      |:.|..::   ::.| 
  Fly   152 VEP-ITSILGGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVS---VITE- 211

  Fly   273 EGDT----LEITRISRLDMGAYLCIASNGVPPTVSKRIKVSV---DFPPMLLIPHQLV 323
            :||.    |.|.|.|..|.|.|.|:.||    ..||.:.|.:   |.|..:...|.||
  Fly   212 KGDITTSYLLIQRASIADSGQYTCLPSN----ANSKSVNVHILKGDHPAAVQKSHLLV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 30/97 (31%)
Ig strand B 130..134 CDD:409405 1/3 (33%)
Ig strand C 143..147 CDD:409405 1/3 (33%)
Ig strand E 178..185 CDD:409405 2/6 (33%)
IgI_1_MuSK 218..310 CDD:409562 27/103 (26%)
Ig strand A 218..221 CDD:409562 1/2 (50%)
Ig strand A' 226..231 CDD:409562 0/4 (0%)
Ig strand B 237..244 CDD:409562 2/6 (33%)
Ig strand C 250..255 CDD:409562 1/4 (25%)
Ig strand C' 257..259 CDD:409562 1/1 (100%)
Ig strand D 267..270 CDD:409562 0/2 (0%)
Ig strand E 275..281 CDD:409562 3/9 (33%)
Ig strand F 288..295 CDD:409562 3/6 (50%)
Ig strand G 302..310 CDD:409562 3/7 (43%)
IG_like 325..410 CDD:214653
Ig strand B 331..335 CDD:143207
Ig strand C 344..348 CDD:143207
Ig strand E 376..380 CDD:143207
Ig strand F 390..395 CDD:143207
Ig strand G 403..406 CDD:143207
dpr21NP_001163838.2 Ig 71..149 CDD:472250 25/82 (30%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 118..122 CDD:409353 2/3 (67%)
Ig strand F 132..137 CDD:409353 2/4 (50%)
Ig 169..249 CDD:472250 24/87 (28%)
Ig strand B 172..176 CDD:409353 1/3 (33%)
Ig strand C 187..191 CDD:409353 0/3 (0%)
Ig strand E 218..222 CDD:409353 1/3 (33%)
Ig strand F 232..237 CDD:409353 2/4 (50%)
Ig strand G 246..249 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.