DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and cd4-1

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001128568.1 Gene:cd4-1 / 799982 ZFINID:ZDB-GENE-100922-280 Length:474 Species:Danio rerio


Alignment Length:310 Identity:68/310 - (21%)
Similarity:113/310 - (36%) Gaps:65/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 VTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNP----------RISVTHDKHD 176
            ||:|..:..:...::|....| |.|  |.:|.:      .|.|||          |:|::.|   
Zfish    31 VTLPREKIERKYSNIKTQDIY-VNW--FLESTL------TINRNPQSSSSKGTNARVSLSAD--- 83

  Fly   177 RHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGY-LNVVVPPNIDDSLSSSDVIVREGANISLR 240
                :.|.|:.|.|.|...:.|:.:.:....:..| |:.|..|.:...|....:.::...::|  
Zfish    84 ----FSLQISPVEESDFVIWRCEQHVLARNYKKTYKLHKVSIPKVPALLVGGRLFLKYVKDVS-- 142

  Fly   241 CRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLC------------- 292
                 |..|.:.|....|.....:||      ..||:.:..:|....|.:.|             
Zfish   143 -----SVNPSVTWISPKNEGCQEHKN------AKDTVLVPSVSTCHNGVWTCQLKYENKKTEATT 196

  Fly   293 -IASNGVPPTVSKRIKVSVDFPPMLLIPHQLVGA-P-EGFNVTIE----CFTE-AHPTS-LNYWT 348
             ::...:.|:.:..|..|:.....:.||..|..| | ...|.|::    .||. :.|.| |:..|
Zfish   197 TVSVIDLAPSPADPIYTSISQSSTVSIPCALSSAIPWSVLNETLQGGSWSFTPLSEPRSPLSLLT 261

  Fly   349 RGEGPIIHDSHKYKVEATVGLPAYKTHMKLTIIN--VSSGDDGIYKCVAK 396
            ...|.::..........|.|......| .|:|.|  |.....|:|||..|
Zfish   262 LNVGSVVRWDLANGANFTDGKRVITNH-NLSIQNLPVKETIRGVYKCSLK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 24/104 (23%)
Ig 130..200 CDD:143165 19/79 (24%)
I-set 226..310 CDD:254352 14/97 (14%)
IGc2 233..298 CDD:197706 12/78 (15%)
Ig 313..410 CDD:299845 26/94 (28%)
IG_like 325..410 CDD:214653 23/82 (28%)
cd4-1NP_001128568.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.