DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-zeta and DIP-delta

DIOPT Version :9

Sequence 1:NP_723441.2 Gene:DIP-zeta / 34231 FlyBaseID:FBgn0051708 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:454 Identity:195/454 - (42%)
Similarity:267/454 - (58%) Gaps:44/454 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 SNL--NIVVEEPEFTEYIENVTVPAGRNVKLGCSVKNLGSYKVAWMHFEQSAILTVHNHVITRNP 166
            :||  :::::||.|.:.|.||||..||:..|.|.|::||.|||||:|.::..|||:|.|||:|.|
  Fly    33 TNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIP 97

  Fly   167 RISVTHDKHDRHRTWYLHINNVHEEDRGRYMCQINTVTAKTQFGYLNVVVPPNIDDSLSS-SDVI 230
            |.|:|:..:    ||.||:|..|::|||.||||:||....:|.|||.|||||||.|..|: |.|.
  Fly    98 RYSITYTDN----TWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVA 158

  Fly   231 VREGANISLRCRASGSPRPIIKWKRDDNSRIAINKNHIVNEWEGDTLEITRISRLDMGAYLCIAS 295
            |||..||::.|||.|.|.|.|.|:|:|...||:.|...|..::.|.|.:|::||.:||||||||:
  Fly   159 VRENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIAT 223

  Fly   296 NGVPPTVSKRIKVSVDFPPMLLIPHQLVGAPEGFNVTIECFTEAHPTSLNYWTRGEGPIIHDSHK 360
            |||||:|||||.:.|:|.||:.:|:||||||.|.:|||:|.|||||.::.||......:: .|.|
  Fly   224 NGVPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVL-PSKK 287

  Fly   361 YKVEATVGLPAYKTHMKLTIINVSSGDDGIYKCVAKNPRGETDGIIRLYVSYPPTTASSGIYSTD 425
            ||.:.|..  :|:.||||||.|:..||.|.|:|::||..|||:|.||:|....|:|.|..:..|.
  Fly   288 YKTDYTEN--SYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSKQVTHTT 350

  Fly   426 THWGENGI---NNNYAYGGPDSTRSI-----YAQDKNTRY---QSNLNEIGLSEQKSFLDKTQNP 479
            ....||.|   :.|      |:|:|:     ||. ||..|   .|:.:..|.|...|.....|..
  Fly   351 VESRENNIIPSSRN------DTTKSLQTDVGYAM-KNDLYPGSASSSSSGGSSSAASSSSSMQTS 408

  Fly   480 LLANGNANEADAESNGARGHNPSMAIA------------WLFVVIATLLLTIRSAVGSSHSLSL 531
            .|..|.|..: ..|.|::|   |:||.            :....:|.|||......||...|:|
  Fly   409 ALPGGVAGNS-LSSMGSKG---SLAIGKSTFYTERPPNEYAASSVAGLLLHRALLFGSGIYLTL 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-zetaNP_723441.2 IG_like 120..216 CDD:214653 49/95 (52%)
Ig 130..200 CDD:143165 35/69 (51%)
I-set 226..310 CDD:254352 44/84 (52%)
IGc2 233..298 CDD:197706 31/64 (48%)
Ig 313..410 CDD:299845 47/96 (49%)
IG_like 325..410 CDD:214653 40/84 (48%)
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 49/95 (52%)
Ig 145..238 CDD:416386 49/92 (53%)
Ig strand A 145..149 CDD:409353 3/3 (100%)
Ig strand A' 154..159 CDD:409353 2/4 (50%)
Ig strand B 165..172 CDD:409353 3/6 (50%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 6/6 (100%)
Ig strand G 230..238 CDD:409353 5/7 (71%)
Ig 242..333 CDD:416386 46/93 (49%)
Ig strand A' 250..253 CDD:409353 2/2 (100%)
Ig strand B 259..266 CDD:409353 4/6 (67%)
Ig strand C 272..277 CDD:409353 2/4 (50%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 5/11 (45%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 6/8 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10955
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4644
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102261at50557
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm26286
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
98.970

Return to query results.
Submit another query.